DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpS2 and igsf10

DIOPT Version :9

Sequence 1:	NP_001260303.1	Gene:	RpS2 / 34309	FlyBaseID:	FBgn0004867	Length:	267	Species:	Drosophila melanogaster
Sequence 2:	XP_012819117.2	Gene:	igsf10 / 100494018	XenbaseID:	XB-GENE-6072998	Length:	2884	Species:	Xenopus tropicalis

Alignment Length:	304	Identity:	64/304 - (21%)
Similarity:	103/304 - (33%)	Gaps:	100/304 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 GRGKEDSKEWVPVTKLGRLVRE----------------------------------GKIKSLEEI 64
            |.|.||::|....:.:||:..:                                  |:.:...:|
Frog   676 GSGNEDNEELNKQSAMGRVTVQKKTPVHIESGHVLSRKTHRNIGIHRRKKISRRLRGQRRKFTQI 740

  Fly    65 YLYSLPIKEFEIIDFFLGSSLKDEV-LKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 128
            .....|::..||::....:|.|.:| .||.   :.:...:.|..:|...:.:::|...|.||...
Frog   741 NRKIDPVRWTEILEKTKQNSKKPKVETKIF---ESSLKEEYTIGRASGDLEESSGEELLPVKEKF 802

  Fly   129 EVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRG--------- 184
            .:.|....||  .||:|||..:....:|     |:..:.|.|..|||     .||.
Frog   803 FILTTRHSAI--TKLNVVPTTKTVTDSK-----TLQTQPTKKPSSVS-----TPRAETETMENLM 855

  Fly   185 TGIVSAP----------------VPKKLLTMAGIEDCYTSARGSTGT--LGNFA----------- 220
            ...||||                :.|...|.:|:   |.:.:..|.|  |||.|
Frog   856 ANTVSAPSEPTTHSLLNNTSMELISKPQPTSSGL---YATPKDLTTTSLLGNAAIFHHGKPQDPK 917

  Fly   221 ---KATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTP 261
               ..|:.::.     :||......| .||....|:...|..||
Frog   918 KELTTTFNSLT-----VTPQTVITSP-SSTSSNIYTTSPSPATP 955

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpS2	NP_001260303.1	uS5_euk_arch	37..245	CDD:273398	56/283 (20%)
		Ribosomal_S5	85..149	CDD:278748	18/64 (28%)
		Ribosomal_S5_C	168..235	CDD:281681	22/107 (21%)
igsf10	XP_012819117.2	leucine-rich repeat	40..59	CDD:275380
		leucine-rich repeat	60..83	CDD:275380
		PPP1R42	68..221	CDD:411060
		LRR_8	82..142	CDD:404697
		leucine-rich repeat	84..107	CDD:275380
		leucine-rich repeat	108..131	CDD:275380
		leucine-rich repeat	132..155	CDD:275380
		leucine-rich repeat	156..187	CDD:275380
		leucine-rich repeat	188..211	CDD:275380
		PCC	193..>277	CDD:188093
		Ig	477..552	CDD:416386
		Ig strand A'	481..484	CDD:409353
		Ig strand B	490..497	CDD:409353
		Ig strand C	503..509	CDD:409353
		Ig strand C'	511..517	CDD:409353
		Ig strand D	524..528	CDD:409353
		Ig strand E	531..536	CDD:409353
		Ig strand F	544..552	CDD:409353
		IGc2	585..649	CDD:197706
		Ig strand C	601..606	CDD:409353
		Ig strand C'	608..612	CDD:409353
		Ig strand D	617..622	CDD:409353
		Ig strand E	625..631	CDD:409353
		Ig strand F	638..646	CDD:409353
		Herpes_BLLF1	<885..1272	CDD:282904	19/80 (24%)
		Ig_3	1904..1984	CDD:404760
		Ig strand C	1936..1940	CDD:409353
		Ig strand E	1963..1967	CDD:409353
		Ig strand F	1977..1982	CDD:409353
		Ig strand G	1991..1994	CDD:409353
		Ig_3	2001..2081	CDD:404760
		Ig strand A'	2011..2014	CDD:409353
		Ig strand B	2020..2027	CDD:409353
		Ig strand C	2033..2038	CDD:409353
		Ig strand C'	2040..2042	CDD:409353
		Ig strand D	2053..2057	CDD:409353
		Ig strand E	2060..2065	CDD:409353
		Ig strand F	2073..2081	CDD:409353
		Ig strand G	2084..2094	CDD:409353
		Ig_3	2098..2177	CDD:404760
		Ig strand A	2098..2101	CDD:409353
		Ig strand A'	2107..2110	CDD:409353
		Ig strand B	2117..2124	CDD:409353
		Ig strand C	2130..2136	CDD:409353
		Ig strand C'	2142..2144	CDD:409353
		Ig strand D	2150..2155	CDD:409353
		Ig strand E	2157..2161	CDD:409353
		Ig strand F	2170..2178	CDD:409353
		Ig strand G	2181..2191	CDD:409353
		Ig_3	2198..2277	CDD:404760
		Ig strand B	2214..2223	CDD:409353
		Ig strand C	2229..2238	CDD:409353
		Ig strand D	2250..2253	CDD:409353
		Ig strand E	2256..2262	CDD:409353
		Ig strand F	2269..2277	CDD:409353
		Ig_3	2293..2380	CDD:404760
		Ig strand A'	2304..2309	CDD:409353
		Ig strand C	2326..2330	CDD:409353
		Ig strand D	2355..2358	CDD:409353
		Ig strand E	2359..2364	CDD:409353
		Ig strand F	2372..2380	CDD:409353
		IGc2	2413..2477	CDD:197706
		Ig strand B	2416..2420	CDD:409353
		Ig strand C	2429..2433	CDD:409353
Ig strand E	2453..2457	CDD:409353
Ig strand F	2467..2472	CDD:409353
Ig strand B	2515..2521	CDD:409353
IG_like	2516..2587	CDD:214653
Ig strand C	2527..2532	CDD:409353
Ig strand C'	2534..2536	CDD:409353
Ig strand D	2546..2550	CDD:409353
Ig strand E	2553..2558	CDD:409353
Ig strand F	2566..2574	CDD:409353
Ig strand G	2577..2587	CDD:409353
Ig	2612..2675	CDD:409353
Ig strand B	2612..2616	CDD:409353
Ig strand C	2625..2629	CDD:409353
Ig strand E	2651..2655	CDD:409353
Ig strand F	2665..2670	CDD:409353
Ig_3	2688..2767	CDD:404760
Ig strand B	2707..2711	CDD:409353
Ig strand C	2720..2724	CDD:409353
Ig strand E	2746..2750	CDD:409353
Ig strand F	2760..2765	CDD:409353
Ig_3	2784..2866	CDD:404760
Ig strand A	2785..2790	CDD:409353
Ig strand A'	2793..2798	CDD:409353
Ig strand B	2801..2810	CDD:409353
Ig strand C	2816..2820	CDD:409353
Ig strand C'	2823..2825	CDD:409353
Ig strand D	2841..2844	CDD:409353
Ig strand E	2845..2850	CDD:409353
Ig strand F	2858..2866	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165177310
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930