DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtDNA-helicase and AT1G30660

DIOPT Version :9

Sequence 1:NP_609318.1 Gene:mtDNA-helicase / 34307 FlyBaseID:FBgn0032154 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_174354.4 Gene:AT1G30660 / 839946 AraportID:AT1G30660 Length:337 Species:Arabidopsis thaliana


Alignment Length:332 Identity:69/332 - (20%)
Similarity:113/332 - (34%) Gaps:106/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VTNAQKGTDHGLLAYVNKRTG---AFICPNCDVKTSLTSALLSYQLP----------KPVGYKQP 129
            ||..:|.::.|:.|. |...|   ..|||.|:|..|...:|..|..|          :..|.|..
plant    36 VTLMRKLSEQGIDAQ-NCPPGVRSCLICPKCEVGDSGEKSLTLYIYPDGSSAKWTCRRKCGLKGV 99

  Fly   130 LQ-------RQPV--YESRFPHLAVVTPEAC-------AALGIKGLK-----------EDQLNAI 167
            ||       :.|:  .|.:....::.....|       ||..|.|..           :|::...
plant   100 LQVDGKLVSKDPIGKVERKITVESIKLEPLCDEIQDFFAARAISGKTLERNRVMQKRIDDEIVIA 164

  Fly   168 GAQWEPQQQLLHFKLRNAAQVEVGE----KVLYLGDRREEIFQSSSSSGLLIHGAMNKTKAVLVS 228
            ...|: :.:|:..|.|:..:..|.|    |:||..|..||     :|..:::.|..:|       
plant   165 FTYWQ-RGELVSCKYRSLTKKFVQERNTRKILYGLDDIEE-----TSEIIIVEGEPDK------- 216

  Fly   229 NLIDFIVLATQNIETHCVVCLP------YELKTLPQE-----------CLPALERFKELIFWLHY 276
                   ||.:.......|.:|      ...|.:|.|           |...|::...::  :..
plant   217 -------LAMEEAGFFNCVSVPDGAPETVSSKEIPSESKDTAFKYIWNCNDYLKKASRIV--IAT 272

  Fly   277 DASHSWDA-ARAFALKLDERRCLLIR-PTETE-------------PAPHLALRRRLNLRHILAKA 326
            |......| |...|.:|.:.||.|:: |.::|             ..|||       |:..:..|
plant   273 DGDGPGQALAEELARRLGKERCWLVKWPKKSEDEHFKDANEVLMSKGPHL-------LKEAILNA 330

  Fly   327 TPVQHKA 333
            .|...|:
plant   331 EPYPLKS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtDNA-helicaseNP_609318.1 GP4d_helicase 342..598 CDD:238542
AT1G30660NP_174354.4 Toprim_4 205..294 CDD:290388 17/104 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D212176at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.