DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and AT1G61780

DIOPT Version :9

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_176371.1 Gene:AT1G61780 / 842475 AraportID:AT1G61780 Length:98 Species:Arabidopsis thaliana


Alignment Length:99 Identity:53/99 - (53%)
Similarity:68/99 - (68%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCEKCEAKLSKVSAPNPWR---TSTAPAGGRKINENKALSSARERYNPIGTALPPCRICRQKVH 62
            |||:|||.|||||..|:.|:   .:....|||||||||.||. :.|::|..|....|.||:|:||
plant     1 MVCDKCEKKLSKVIVPDKWKDGARNVTEGGGRKINENKLLSK-KNRWSPYSTCTTKCMICKQQVH 64

  Fly    63 QMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSS 96
            |.|. ||..|||.|.:||||||::::||.||||:
plant    65 QDGK-YCHTCAYSKGVCAMCGKQVLDTKMYKQSN 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:287237 43/86 (50%)
AT1G61780NP_176371.1 Cript 11..96 CDD:402028 43/86 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2540
eggNOG 1 0.900 - - E1_KOG3476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8572
Inparanoid 1 1.050 113 1.000 Inparanoid score I2050
OMA 1 1.010 - - QHG57707
OrthoDB 1 1.010 - - D1599604at2759
OrthoFinder 1 1.000 - - FOG0006025
OrthoInspector 1 1.000 - - oto4250
orthoMCL 1 0.900 - - OOG6_104550
Panther 1 1.100 - - LDO PTHR11805
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4321
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.