DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and Cript

DIOPT Version :9

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_063972.1 Gene:Cript / 56725 RGDID:621545 Length:101 Species:Rattus norvegicus


Alignment Length:100 Identity:60/100 - (60%)
Similarity:75/100 - (75%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCEKCEAKLSKVSAPNPWR---TSTAPAGGRKINENKALSSARERYNPIG-TALPPCRICRQKV 61
            |||||||.||.:|..|:.|:   .:|..:||||:||||||:|.:.|::|.| .....||||:..|
  Rat     1 MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSV 65

  Fly    62 HQMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSS 96
            ||.||||||.|||||.||||||||:::||||||:|
  Rat    66 HQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:287237 49/87 (56%)
CriptNP_063972.1 Cript 11..99 CDD:402028 49/87 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..38 8/18 (44%)
Sufficient for interaction with DLG4. /evidence=ECO:0000269|PubMed:9581762 95..101 4/5 (80%)
PDZ3-binding 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353264
Domainoid 1 1.000 113 1.000 Domainoid score I5993
eggNOG 1 0.900 - - E1_KOG3476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8572
Inparanoid 1 1.050 133 1.000 Inparanoid score I4506
OMA 1 1.010 - - QHG57707
OrthoDB 1 1.010 - - D1599604at2759
OrthoFinder 1 1.000 - - FOG0006025
OrthoInspector 1 1.000 - - oto96041
orthoMCL 1 0.900 - - OOG6_104550
Panther 1 1.100 - - LDO PTHR11805
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4321
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.