DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and cript

DIOPT Version :9

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001016794.1 Gene:cript / 549548 XenbaseID:XB-GENE-486540 Length:101 Species:Xenopus tropicalis


Alignment Length:100 Identity:59/100 - (59%)
Similarity:73/100 - (73%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCEKCEAKLSKVSAPNPWRT---STAPAGGRKINENKALSSARERYNPIG-TALPPCRICRQKV 61
            |||:|||.||..|..|:.|::   :|..:||||:||||||:|...|::|.| .....||||:..|
 Frog     1 MVCDKCEKKLGTVITPDTWKSGARNTTESGGRKLNENKALTSKTARFDPYGKNKFAICRICKSSV 65

  Fly    62 HQMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSS 96
            ||.||||||.|||||.||||||||::.||||||:|
 Frog    66 HQPGSHYCQGCAYKKGICAMCGKKVLETKNYKQTS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:287237 49/87 (56%)
criptNP_001016794.1 Cript 11..99 CDD:370906 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6248
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8572
Inparanoid 1 1.050 123 1.000 Inparanoid score I4585
OMA 1 1.010 - - QHG57707
OrthoDB 1 1.010 - - D1599604at2759
OrthoFinder 1 1.000 - - FOG0006025
OrthoInspector 1 1.000 - - oto102775
Panther 1 1.100 - - LDO PTHR11805
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3975
SonicParanoid 1 1.000 - - X4321
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.