DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and C36B1.14

DIOPT Version :9

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001032972.1 Gene:C36B1.14 / 3896719 WormBaseID:WBGene00044614 Length:99 Species:Caenorhabditis elegans


Alignment Length:109 Identity:43/109 - (39%)
Similarity:60/109 - (55%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINEN------------KALSSARERYNPIGTALPP 53
            |||..||.||:|:...:|:|       .:|:|.|            ..|...:::...:|.   .
 Worm     1 MVCGDCEKKLTKIVGVDPYR-------NKKVNRNADGSGPKTVTTKNRLIGVQKKATIVGA---K 55

  Fly    54 CRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSST 97
            |::|:..:||.|||||..|||:|.|||||||||.|||..:||:|
 Worm    56 CKLCKMLIHQPGSHYCSTCAYQKGICAMCGKKIQNTKGLRQSTT 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:287237 33/95 (35%)
C36B1.14NP_001032972.1 Cript 11..97 CDD:287237 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166822
Domainoid 1 1.000 72 1.000 Domainoid score I6096
eggNOG 1 0.900 - - E1_KOG3476
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3693
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57707
OrthoDB 1 1.010 - - D1599604at2759
OrthoFinder 1 1.000 - - FOG0006025
OrthoInspector 1 1.000 - - oto19075
orthoMCL 1 0.900 - - OOG6_104550
Panther 1 1.100 - - LDO PTHR11805
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3975
SonicParanoid 1 1.000 - - X4321
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.