DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and RpII33

DIOPT Version :9

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_477419.1 Gene:RpII33 / 34796 FlyBaseID:FBgn0026373 Length:275 Species:Drosophila melanogaster


Alignment Length:32 Identity:6/32 - (18%)
Similarity:15/32 - (46%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YCQACAYKKAICAMCGK---KIMNTKNYKQSS 96
            :|..|:.:..:...|.:   :.:.|.:.|.|:
  Fly    93 FCPECSVEFTLDVKCSEEQTRHVTTADLKSSN 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:287237 5/29 (17%)
RpII33NP_477419.1 RNAP_II_RPB3 7..267 CDD:132909 6/32 (19%)
RPOLD 19..261 CDD:214766 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.