DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4537 and Polr1C

DIOPT Version :10

Sequence 1:NP_001097135.1 Gene:CG4537 / 34306 FlyBaseID:FBgn0032153 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_608885.1 Gene:Polr1C / 33712 FlyBaseID:FBgn0031657 Length:333 Species:Drosophila melanogaster


Alignment Length:42 Identity:11/42 - (26%)
Similarity:20/42 - (47%) Gaps:5/42 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KALSSARERYNPIGTA----LPPCRICRQKVHQMGSHYCQAC 72
            |.|.....:::|:.||    ||..::.|: |....::..|.|
  Fly   209 KGLGRDHAKFSPVATATYRLLPMIKLNRE-VTGKDAYLLQNC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4537NP_001097135.1 Cript 11..95 CDD:431159 11/42 (26%)
Polr1CNP_608885.1 RNAP_I_II_AC40 41..329 CDD:132910 11/42 (26%)

Return to query results.
Submit another query.