DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha6 and lgc-24

DIOPT Version :9

Sequence 1:NP_995675.1 Gene:nAChRalpha6 / 34304 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001123110.2 Gene:lgc-24 / 6418837 WormBaseID:WBGene00045385 Length:389 Species:Caenorhabditis elegans


Alignment Length:324 Identity:72/324 - (22%)
Similarity:115/324 - (35%) Gaps:64/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RLLNHLLSTYNTLERPVAN----ESEP-LEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNL 91
            :|.:.|...||. ..||..    |:.| |||.|    ...||.|.....:..||  .|.|.|..|
 Worm    30 KLRSDLFKNYNG-SMPVGKGEYLEATPSLEVGF----IHFIDDDHGFMSVVINA--ELTWIDERL 87

  Fly    92 RWNETEYGGVKDL-------RITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGI 149
            :||...|.||:::       | ..|..|.| ::.|.|.|..:.   ..:::...:...|....|.
 Worm    88 KWNPANYSGVREIVEKTFEFR-KDNNCWMP-IVKYRSYDRRYS---ELDLLEFSDARTLISYKGE 147

  Fly   150 FKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFIT-NG------------ 201
            .|:..:..:|      ..|:..||.:..|.....::|......|...|:: ||            
 Worm   148 IKTALQTMVT------TKCQFSFGEYPNDYQNCSIMLIPNQNADEFRFVSPNGYCNPKFENLEHR 206

  Fly   202 --EWYLLAMPGKKNTIVYACCPEPY-------------VDITFTIQIRRRTLYYFFNLIVPCVLI 251
              ..:.|.:.|.::.|.|......:             .:..|.:..:|........|.:|.:||
 Worm   207 AVRVHDLHLMGVESNIFYTFANTYFTAEEVTGFEYMAKTEFRFNLMFKRVNKLLNVKLSIPSILI 271

  Fly   252 SSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNL-VAESMPTTSDAVPLIGVTILLSL--TVFL 312
            |...::....|  :|..: .|......:.|...| |::.:|.....:|..|...|..|  ||||
 Worm   272 SMFLIIAGLFP--NGYSI-FGYAYCFFVEVMHGLYVSKILPNDIRGIPYHGALALCFLIETVFL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 72/324 (22%)
LGIC_ECD_nAChR 55..236 CDD:349798 43/215 (20%)
lgc-24NP_001123110.2 LGIC_ECD 62..226 CDD:355788 38/176 (22%)
Cys-loop 160..174 CDD:349787 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.