DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha6 and LOC103909988

DIOPT Version :9

Sequence 1:NP_995675.1 Gene:nAChRalpha6 / 34304 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster
Sequence 2:XP_021326666.1 Gene:LOC103909988 / 103909988 -ID:- Length:114 Species:Danio rerio


Alignment Length:93 Identity:43/93 - (46%)
Similarity:61/93 - (65%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EKRLLNHLLST--YNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLR 92
            |:||:.|||:.  ||.|.||..|.||.:.|:..::|.|:|.|.|:.||:|||.||..||.||.|.
Zfish    21 EERLVEHLLNPAHYNKLIRPATNGSEVVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWQDYRLT 85

  Fly    93 WNETEYGGVKDLRITPNKLWKPDVLMYN 120
            |:..|:.|:|.:|:....:|.|||::||
Zfish    86 WSPEEFDGMKKVRLPSKHIWLPDVVLYN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 43/93 (46%)
LGIC_ECD_nAChR 55..236 CDD:349798 29/66 (44%)
LOC103909988XP_021326666.1 Neur_chan_LBD 21..>114 CDD:332142 43/93 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.