DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13123 and ZNF112

DIOPT Version :9

Sequence 1:	NP_609315.1	Gene:	CG13123 / 34303	FlyBaseID:	FBgn0032150	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001335210.1	Gene:	ZNF112 / 7771	HGNCID:	12892	Length:	930	Species:	Homo sapiens

Alignment Length:	86	Identity:	26/86 - (30%)
Similarity:	40/86 - (46%)	Gaps:	10/86 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   226 YKCQYCPLAYASPQYLKTHVRNSHV------CKYCTTAFAKVRDLNEH--IRQKHPHHQCVVCSN 282
            |||:.|...::....|:.|.| .||      |:.|...|:....|..|  :......::|.||..
Human   794 YKCEVCTKGFSESSRLQAHQR-VHVEGRPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGK 857

  Fly   283 NFSTSSNLRAHLKKIHGVQLP 303
            .||..|||:|| :::|..:.|
Human   858 GFSQRSNLQAH-QRVHTGEKP 877

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13123	NP_609315.1	zf-AD	6..82	CDD:285071
		PHA00733	175..272	CDD:177301	14/53 (26%)
		C2H2 Zn finger	228..245	CDD:275368	3/16 (19%)
		C2H2 Zn finger	251..272	CDD:275368	5/22 (23%)
		C2H2 Zn finger	277..298	CDD:275368	10/20 (50%)
ZNF112	NP_001335210.1	KRAB	25..85	CDD:214630
		C2H2 Zn finger	250..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..321	CDD:275368
		C2H2 Zn finger	350..370	CDD:275368
		COG5048	401..773	CDD:227381
		C2H2 Zn finger	406..426	CDD:275368
		C2H2 Zn finger	434..454	CDD:275368
		C2H2 Zn finger	462..482	CDD:275368
		C2H2 Zn finger	520..536	CDD:275368
		C2H2 Zn finger	544..564	CDD:275368
		C2H2 Zn finger	572..592	CDD:275368
		C2H2 Zn finger	600..620	CDD:275368
		C2H2 Zn finger	628..648	CDD:275368
		C2H2 Zn finger	656..676	CDD:275368
		C2H2 Zn finger	684..704	CDD:275368
		C2H2 Zn finger	712..732	CDD:275368
		C2H2 Zn finger	740..760	CDD:275368
		C2H2 Zn finger	768..788	CDD:275368
		SFP1	<780..873	CDD:227516	24/80 (30%)
		C2H2 Zn finger	796..816	CDD:275368	5/20 (25%)
		C2H2 Zn finger	824..844	CDD:275368	5/19 (26%)
		C2H2 Zn finger	852..872	CDD:275368	10/20 (50%)
		zf-H2C2_2	864..888	CDD:316026	6/15 (40%)
		C2H2 Zn finger	880..900	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000