DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13123 and Ovol3

DIOPT Version :9

Sequence 1:	NP_609315.1	Gene:	CG13123 / 34303	FlyBaseID:	FBgn0032150	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001276746.1	Gene:	Ovol3 / 381867	MGIID:	2388075	Length:	189	Species:	Mus musculus

Alignment Length:	93	Identity:	31/93 - (33%)
Similarity:	41/93 - (44%)	Gaps:	11/93 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   228 CQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEHIRQK---HPHHQCVVCSNNF 284
            |..||.|:...:.|..|::     ..|||.||...|....||..|:|..   .| .:|..|...|
Mouse    71 CPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMRTHTGIRP-FRCGACGKAF 134

  Fly   285 STSSNLRAHLKKIHGVQLPAQVALLDYR 312
            :...:|.|||.|:||  .||..|..:.|
Mouse   135 TQRCSLEAHLAKVHG--QPASYAYRERR 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13123	NP_609315.1	zf-AD	6..82	CDD:285071
		PHA00733	175..272	CDD:177301	16/51 (31%)
		C2H2 Zn finger	228..245	CDD:275368	5/16 (31%)
		C2H2 Zn finger	251..272	CDD:275368	8/23 (35%)
		C2H2 Zn finger	277..298	CDD:275368	8/20 (40%)
Ovol3	NP_001276746.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		C2H2 Zn finger	71..91	CDD:275368	6/19 (32%)
		zf-C2H2	97..119	CDD:395048	10/21 (48%)
		C2H2 Zn finger	99..119	CDD:275368	8/19 (42%)
		zf-H2C2_2	111..136	CDD:404364	8/25 (32%)
		C2H2 Zn finger	127..148	CDD:275368	8/20 (40%)
		C2H2 Zn finger	166..186	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10032
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100