DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and ovo

DIOPT Version :9

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster


Alignment Length:86 Identity:21/86 - (24%)
Similarity:40/86 - (46%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 YKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEHIRQKHPH-----HQCVVC 280
            :.|:.|...::..:.|..|::     ..::|.:|...|....||..|.|   .|     ::|.:|
  Fly  1197 FVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTR---THTGVRPYKCNLC 1258

  Fly   281 SNNFSTSSNLRAHLKKIHGVQ 301
            ..:|:...:|.:|.:|:|.||
  Fly  1259 EKSFTQRCSLESHCQKVHSVQ 1279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:285071
PHA00733 175..272 CDD:177301 11/50 (22%)
C2H2 Zn finger 228..245 CDD:275368 3/16 (19%)
C2H2 Zn finger 251..272 CDD:275368 7/20 (35%)
C2H2 Zn finger 277..298 CDD:275368 6/20 (30%)
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 4/19 (21%)
zf-H2C2_2 1212..1235 CDD:290200 4/22 (18%)
C2H2 Zn finger 1227..1247 CDD:275368 7/22 (32%)
zf-H2C2_2 1239..1264 CDD:290200 8/27 (30%)
C2H2 Zn finger 1255..1276 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10032
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.