DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and Ovol1

DIOPT Version :9

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_008758360.2 Gene:Ovol1 / 309164 RGDID:1306956 Length:272 Species:Rattus norvegicus


Alignment Length:167 Identity:41/167 - (24%)
Similarity:66/167 - (39%) Gaps:46/167 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ATTAQP-----RLDLSDSQLEQLESPAYEMRTVDYAAVELKHYNLDEYNEANRLLDVE------- 218
            |:.|:|     .||:|      |...:|.:.:......:|..      .:.|.|.|.:       
  Rat    54 ASVAEPPSCPLALDMS------LRDSSYGVASGPCEVAQLPP------EDVNHLTDPQSRDQGFL 106

  Fly   219 -----------PSGSQAIYKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEH 267
                       |:|.  ::.|..|..::...:.|..|::     ..|:|.||...|....||..|
  Rat   107 RTKMKVTLGDSPNGD--LFTCHICQKSFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRH 169

  Fly   268 IRQK---HPHHQCVVCSNNFSTSSNLRAHLKKIHGVQ 301
            :|..   .| ::|.:|...|:...:|.:|||||||||
  Rat   170 VRTHTGVRP-YKCSLCDKAFTQRCSLESHLKKIHGVQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:285071
PHA00733 175..272 CDD:177301 22/122 (18%)
C2H2 Zn finger 228..245 CDD:275368 3/16 (19%)
C2H2 Zn finger 251..272 CDD:275368 8/23 (35%)
C2H2 Zn finger 277..298 CDD:275368 8/20 (40%)
Ovol1XP_008758360.2 C2H2 Zn finger 125..145 CDD:275368 4/19 (21%)
C2H2 Zn finger 153..173 CDD:275368 8/19 (42%)
zf-H2C2_2 165..190 CDD:404364 8/25 (32%)
C2H2 Zn finger 181..202 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10032
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.