DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and Ovol2

DIOPT Version :9

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_038960525.1 Gene:Ovol2 / 296201 RGDID:1306130 Length:274 Species:Rattus norvegicus


Alignment Length:221 Identity:47/221 - (21%)
Similarity:84/221 - (38%) Gaps:59/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EEEPENQASDEFEILEEFRRIPLDYVVLDPDRPTETRQTRRRTDSCTKPSQRLANQDSLIVSEFL 164
            :|.|:::.:|.:        ||:....|..|.|.:.|.....:..|:..:......:|       
  Rat    20 DELPDDKRADTY--------IPVSLGCLLRDPPEDCRSDGGSSSGCSCSAGEPGGAES------- 69

  Fly   165 PATTAQPR-----------LDLSDSQLEQLESPAYEMRTVDYAAVELKHYNLDEYNEANRLLDVE 218
               ::.||           .:.:|..|..::.|.        |..::| :.....|::       
  Rat    70 ---SSSPRAPEPETPELHDAEGTDGHLAAMQRPV--------ARSKIK-FTTGTCNDS------- 115

  Fly   219 PSGSQAIYKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEHIRQK---HPHH 275
                 .|:.|..|..::...:.|..|::     ..|:|.:|...|....||..|:|..   .| :
  Rat   116 -----VIHNCDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRP-Y 174

  Fly   276 QCVVCSNNFSTSSNLRAHLKKIHGVQ 301
            :|.||...|:...:|.:|||||||||
  Rat   175 KCEVCYKAFTQRCSLESHLKKIHGVQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:285071
PHA00733 175..272 CDD:177301 19/104 (18%)
C2H2 Zn finger 228..245 CDD:275368 3/16 (19%)
C2H2 Zn finger 251..272 CDD:275368 7/23 (30%)
C2H2 Zn finger 277..298 CDD:275368 9/20 (45%)
Ovol2XP_038960525.1 COG5048 118..>169 CDD:227381 12/50 (24%)
C2H2 Zn finger 120..140 CDD:275368 4/19 (21%)
C2H2 Zn finger 148..168 CDD:275368 7/19 (37%)
zf-H2C2_2 160..185 CDD:404364 9/25 (36%)
zf-C2H2_3rep 176..>237 CDD:408638 14/25 (56%)
C2H2 Zn finger 176..197 CDD:275368 9/20 (45%)
C2H2 Zn finger 215..232 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10032
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.