DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and ovol1b

DIOPT Version :9

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_003200887.1 Gene:ovol1b / 100534921 ZFINID:ZDB-GENE-091204-357 Length:285 Species:Danio rerio


Alignment Length:178 Identity:45/178 - (25%)
Similarity:76/178 - (42%) Gaps:33/178 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SCTKPSQR---LANQDSLIVSEFLPATTAQPRLDLSDSQLEQLESPAYEMRTVDYAAVELK---- 201
            ||...:|:   ..:..|.:.|..||:..||.:....|.:.      ....::|.|...::|    
Zfish    53 SCLTAAQKNSTFLHVQSHVPSAQLPSFAAQGQPGNHDPEC------CIRTQSVPYMRSKIKVTTG 111

  Fly   202 ----HYNLDEYNEANRLLDVEPSGSQAIYKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTA 257
                |......| |.:::|:.|:.|.  ..||.|...:.:.:.||.|::     ..:.|::|...
Zfish   112 NMPSHQPASPEN-ARKIVDIPPADSG--LSCQVCQKTFTTARMLKRHLKCHSETKKYSCEHCGKG 173

  Fly   258 FAKVRDLNEHIRQKHPH-----HQCVVCSNNFSTSSNLRAHLKKIHGV 300
            |....||..|:|   .|     ::|.:|:..|:...:|.|||||||.|
Zfish   174 FNDTFDLKRHVR---THTGVRPYKCTMCAKAFTQRCSLEAHLKKIHAV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:285071
PHA00733 175..272 CDD:177301 23/109 (21%)
C2H2 Zn finger 228..245 CDD:275368 5/16 (31%)
C2H2 Zn finger 251..272 CDD:275368 7/20 (35%)
C2H2 Zn finger 277..298 CDD:275368 9/20 (45%)
ovol1bXP_003200887.1 C2H2 Zn finger 139..159 CDD:275368 6/19 (32%)
zf-H2C2_2 151..175 CDD:290200 5/23 (22%)
zf-C2H2 165..187 CDD:278523 7/24 (29%)
C2H2 Zn finger 167..187 CDD:275368 7/22 (32%)
zf-H2C2_2 179..204 CDD:290200 8/27 (30%)
C2H2 Zn finger 195..216 CDD:275368 9/20 (45%)
C2H2 Zn finger 234..251 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10032
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.