DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4036 and ALKBH4

DIOPT Version :9

Sequence 1:NP_001188762.1 Gene:CG4036 / 34302 FlyBaseID:FBgn0032149 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_060091.1 Gene:ALKBH4 / 54784 HGNCID:21900 Length:302 Species:Homo sapiens


Alignment Length:292 Identity:109/292 - (37%)
Similarity:164/292 - (56%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRPCGCKGVRTCLSCEQ--------DFHIAKTSLREQFQQLEAWSYCIQCDLLQRGWDTNHVQKD 60
            :|.|||||:||||.||:        :...|||         ..:.||     ...||.....:.|
Human    12 LRECGCKGIRTCLICERQRGSDPPWELPPAKT---------YRFIYC-----SDTGWAVGTEESD 62

  Fly    61 HENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWDISQSGRRKQNFGPKTNFKKRKLRLG 125
            .|..    ..|.||:::.|:|::.:|.|:|:..:|..||.:||||||||::|||.||:|:||:..
Human    63 FEGW----AFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTE 123

  Fly   126 SFAGFPRTTEYVQRRFEDVPLLRGFQTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGD 190
            .|.|.|..:..|.||....|.|.||:.:|||:|:|.|.:|::||||:||.|:||||:|::|.|..
Human   124 GFCGLPSFSREVVRRMGLYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSP 188

  Fly   191 SVLTLTPYEVQQSGKYNLDLVAS-----YEDELLAP----LLTDDQLATFEGKVLRIPMPNLSLI 246
            :||::..   :..|...|....|     ..|.::||    |..:.::|        ||:|..||:
Human   189 TVLSMCR---EAPGSLLLCSAPSAAPEALVDSVIAPSRSVLCQEVEVA--------IPLPARSLL 242

  Fly   247 VLYGPARYQFEHSVLREDVQERRVCVAYREFT 278
            ||.|.||:|::|::.|..::.|||||.:||.:
Human   243 VLTGAARHQWKHAIHRRHIEARRVCVTFRELS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4036NP_001188762.1 2OG-FeII_Oxy 73..>190 CDD:194067 57/116 (49%)
ALKBH4NP_060091.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9747
Inparanoid 1 1.050 193 1.000 Inparanoid score I3851
Isobase 1 0.950 - 0 Normalized mean entropy S4846
OMA 1 1.010 - - QHG51912
OrthoDB 1 1.010 - - D515410at33208
OrthoFinder 1 1.000 - - FOG0007439
OrthoInspector 1 1.000 - - oto88974
orthoMCL 1 0.900 - - OOG6_106336
Panther 1 1.100 - - LDO PTHR12463
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4092
SonicParanoid 1 1.000 - - X5571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.