DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and ip6k1

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001072585.1 Gene:ip6k1 / 780040 XenbaseID:XB-GENE-921615 Length:412 Species:Xenopus tropicalis


Alignment Length:333 Identity:69/333 - (20%)
Similarity:119/333 - (35%) Gaps:115/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HKQAKPQGWMQLSGHPESIVP----------TSTGIVRKRISGLEDSEVHAYR-------LICKE 199
            ||:.    |.||:......||          ..:.:..:.:.|  :||:.:.|       |.|.:
 Frog   134 HKEE----WPQLTSENTESVPEMKSPKLELLMQSDVPFQMLDG--NSEISSERISYNPWSLRCHK 192

  Fly   200 PQTAQIVPAYFGIQEMQSQ-------HFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRP 257
            .|          :..|:|:       .|:.|::::..|..|||:|:|||:|              
 Frog   193 QQ----------LNRMRSESKERKLYKFLLLENVVHHFEIPCVLDLKMGTR-------------- 233

  Fly   258 DLYQKMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRL-------------- 308
                     ..|.....|..||.:.|...       |:|.:.|.|:..:::              
 Frog   234 ---------QHGDDASEEKAARQMKKCEQ-------STSATLGVRVCGMQVFHVDTGHYLCLNKY 282

  Fly   309 --RGRPPVKDLKTCRSSEQIAQTIEQFL----AARRSVQKELLKRLKHMRLVIEQSTFFASHEII 367
              ||          .|:|...|.:.|:|    ..|..:.:.:|.:|:.::.|:|..   ||:...
 Frog   283 YGRG----------LSTEGFRQALFQYLHNGVRLRVDLFEPILSKLRRLKCVLESQ---ASYRFY 334

  Fly   368 GSSIFIVYD--DDRVGVWLIDFAKCRELPPHVR-VDHRSAWAPGNREE---------GLLRGMDE 420
            .||:.|:||  |....:.....||...|...|| :|...:...|.|::         |.:.|:..
 Frog   335 SSSLLIIYDGRDYPTAIVADPLAKEHALKVDVRMIDFAHSTYKGFRDDPTVHDGPDKGYVLGLRS 399

  Fly   421 LIRSFEEV 428
            ||...|.:
 Frog   400 LINILEHI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 52/237 (22%)
ip6k1NP_001072585.1 IPK 210..405 CDD:367650 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.