DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and Ip6k3

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_008771000.1 Gene:Ip6k3 / 688862 RGDID:1584104 Length:401 Species:Rattus norvegicus


Alignment Length:332 Identity:70/332 - (21%)
Similarity:125/332 - (37%) Gaps:111/332 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QQAH--KQAKPQGWMQ----LSGHPESIVPTSTG--IVRKRIS--GLEDSEVHAYRLICKEPQTA 203
            |.||  |::..:..::    ||.....:|.::.|  |.||..:  ||...:.|..||..:.|   
  Rat   125 QMAHSLKESAAKALLRSDCHLSTQASPLVESAVGSQIERKGFNPWGLHCHQAHLSRLCSQYP--- 186

  Fly   204 QIVPAYFGIQEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDLYQKMIAVDA 268
                      |.:...|:.|:::::.::.||::|:|||:|                       ..
  Rat   187 ----------EDKRHRFLLLENVVSQYKQPCILDLKMGTR-----------------------QH 218

  Fly   269 GAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKT--CR--------SS 323
            |.....|.:||.:.|.       :.|:|...|.||..:::.    ..|.|:  |:        |.
  Rat   219 GDDASEEKKARHMKKC-------AQSTSACLGVRICGMQVY----QTDKKSFLCKDKYYGRKLSV 272

  Fly   324 EQIAQTIEQFL----AARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDD------ 378
            |...|.:.|||    ..|..:.:.:|:||:.:..||...   :|:....||:.|:||.:      
  Rat   273 EGFRQALSQFLHDGIRLRTELLEPILRRLQALLTVIRSQ---SSYRFYSSSLLIIYDGEPPQTAP 334

  Fly   379 ------------------RVGVWLIDFAKCRELPPHVRVDHRSAWAPGNREE----GLLRGMDEL 421
                              :|.|.:||||         ...::.:|......|    |.:.|::.|
  Rat   335 APQTTQGSTSGSTSGDPAKVDVRMIDFA---------HTTYKGSWNERTTYEGPDPGYIFGLENL 390

  Fly   422 IRSFEEV 428
            |....::
  Rat   391 IGILRDI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 52/247 (21%)
Ip6k3XP_008771000.1 IPK 193..395 CDD:281727 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.