DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and IP6K2

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_006713262.1 Gene:IP6K2 / 51447 HGNCID:17313 Length:485 Species:Homo sapiens


Alignment Length:414 Identity:84/414 - (20%)
Similarity:142/414 - (34%) Gaps:162/414 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IPNENCDYLS-LQRSGQAPKNHIQAQDPAQMSLLKFLAINALELSAPATPH--LLQHQ-----QA 151
            :.|.:|:..| |.|.....|:|:                    |....||.  :.||:     ::
Human   158 VDNSDCEPKSKLLRWTTNKKHHV--------------------LETEKTPKDWVRQHRKEEKMKS 202

  Fly   152 HKQAKPQGWMQLSGHPESIVPTSTGIVRKRISGLEDSEVHAYR---LICKEPQTAQIVPAYFGIQ 213
            ||..:...|::.|   |.:..|    |.|:  |...|::..|.   :.|.:.|          :|
Human   203 HKLEEEFEWLKKS---EVLYYT----VEKK--GNISSQLKHYNPWSMKCHQQQ----------LQ 248

  Fly   214 EMQ--SQH-----FIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDLYQKMIAVDAGAP 271
            .|:  ::|     ||.|::|.:.:..|||:|:|||:|                       ..|..
Human   249 RMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTR-----------------------QHGDD 290

  Fly   272 TPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRL--------------RGRPPVKDLKTCRS 322
            ...|..|..|.|.:.       |:|...|.|:..:::              .||.        .|
Human   291 ASEEKAANQIRKCQQ-------STSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRK--------LS 340

  Fly   323 SEQIAQTIEQFLAARRSVQKEL----LKRLKHMRLVIEQSTFFASHEIIGSSIFIVYD------- 376
            .:...:.:.||....|.:::||    ||:|..::.|:|:.   .|:....||:.::||       
Human   341 VQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQ---ESYRFYSSSLLVIYDGKERPEV 402

  Fly   377 -----------------DDRVGVW-------------LIDFA--KCRELPPHVRVDHRSAWAPGN 409
                             |:..|.:             :||||  .|| |.....|.|.      .
Human   403 VLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCR-LYGEDTVVHE------G 460

  Fly   410 REEGLLRGMDELIRSFEEVYARCG 433
            ::.|.:.|:..||....|:....|
Human   461 QDAGYIFGLQSLIDIVTEISEESG 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 54/262 (21%)
IP6K2XP_006713262.1 IPK 262..477 CDD:281727 54/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.