DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and Ip6k1

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_445768.1 Gene:Ip6k1 / 50560 RGDID:71025 Length:433 Species:Rattus norvegicus


Alignment Length:425 Identity:87/425 - (20%)
Similarity:153/425 - (36%) Gaps:170/425 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VEQQQQQQQQQQSNNNNERIPNENCDYLSLQRSGQAPKNHIQAQDPAQMSLLKFLAINALELSAP 140
            |||....:::|....::.|         ||.|||.. .:|  .::.|.:|         .|.|  
  Rat   102 VEQDDTPEREQPRRKHSRR---------SLHRSGSG-SDH--KEEKASLS---------FETS-- 143

  Fly   141 ATPHLLQHQQAHKQAKPQGWMQLSGH---PESIVPTSTGIVRKRISGLEDSEVHAYRLICKEPQT 202
                  :..|..|..|    ::|..|   |..::.:::|:..::||      .:.:.|.|.:.| 
  Rat   144 ------ESSQETKSPK----VELHSHSDVPFQMLDSNSGLSSEKIS------YNPWSLRCHKQQ- 191

  Fly   203 AQIVPAYFGIQEMQSQ-------HFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDLY 260
                     :..|:|:       .|:.|::::..|:.|||:|:|||:|                 
  Rat   192 ---------LSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTR----------------- 230

  Fly   261 QKMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKT----CR 321
                  ..|....||..||.:.|...       |:|.|.|.|:..::      |..|.|    ||
  Rat   231 ------QHGDDASAEKAARQMRKCEQ-------STSASLGVRVCGMQ------VYQLDTGHYLCR 276

  Fly   322 --------SSEQIAQTIEQF----LAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIV 374
                    |.|.....:.|:    |..||.:.:.:|.:|:.::.|:|:.   ||:....||:.::
  Rat   277 NKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQ---ASYRFYSSSLLVI 338

  Fly   375 YDDDRVGVWLIDFAKCR-------------ELPP-----------------------HVR-VDHR 402
            ||.          .:||             |:||                       .|| :|..
  Rat   339 YDG----------KECRSELRLKHVDMGLPEVPPLCGPSTSPSNTSLEAGPSSPPKVDVRMIDFA 393

  Fly   403 SAWAPGNREE---------GLLRGMDELIRSFEEV 428
            .:...|.|::         |.:.|::.||...|::
  Rat   394 HSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQM 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 57/267 (21%)
Ip6k1NP_445768.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..160 19/90 (21%)
IPK 207..426 CDD:397715 57/267 (21%)
Substrate binding. /evidence=ECO:0000250 220..228 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..383 1/20 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.