DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and ITPKB

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_002212.3 Gene:ITPKB / 3707 HGNCID:6179 Length:946 Species:Homo sapiens


Alignment Length:428 Identity:128/428 - (29%)
Similarity:189/428 - (44%) Gaps:97/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PEKKASSKSTSSSRSRSTMAWSNEKLRFSCIDNIGLKQLWKLIALDTSASSKQRSAMMLEVEQQQ 80
            |.:|.||.|.||:...|:...|.|.                 |:.|...:....||.:..::||:
Human   594 PLRKLSSSSASSTGFSSSYEDSEED-----------------ISSDPERTLDPNSAFLHTLDQQK 641

  Fly    81 QQQQQQQSNNNNERIPNENCDYLSLQRSGQAPKNHIQAQDPAQMSLLKFLAINALELSAPATPHL 145
            .:                      :.:|.:..||.:. ..|..||.                   
Human   642 PR----------------------VSKSWRKIKNMVH-WSPFVMSF------------------- 664

  Fly   146 LQHQQAHKQAKPQGWMQLSGHPESIVPTSTGIVRKRISGLEDSEVHAYRLICKEPQTA------- 203
                   |:..|  |:||:||..|....:.|.:.|:         |     |:..|..       
Human   665 -------KKKYP--WIQLAGHAGSFKAAANGRILKK---------H-----CESEQRCLDRLMVD 706

  Fly   204 ---QIVPAYFGIQEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNA----TLRPDLYQ 261
               ..||||.|......:.:.::.||||.|..|||||.|||.||:||.|::.|    :||.|:||
Human   707 VLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQ 771

  Fly   262 KMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKTCRSSEQI 326
            |||.||..|||..|...||:||.|||.:||::||:.:.|||||.::.......:|.|..::.||:
Human   772 KMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQV 836

  Fly   327 AQTIEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYD-DDRVGVWLIDFAKC 390
            .:...:|.....::......|||.:|..:|.|.||..||:||||:..::| .::..||:|||.|.
Human   837 TEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKT 901

  Fly   391 RELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSFEEV 428
            ..||....:.|...|..||||:|.|.|::.|:....|:
Human   902 TPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEM 939

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 87/210 (41%)
ITPKBNP_002212.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..128
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..288
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..638 14/60 (23%)
IPK 726..937 CDD:281727 87/210 (41%)
Calmodulin-binding. /evidence=ECO:0000250 768..776 6/7 (86%)
Substrate binding. /evidence=ECO:0000250 793..800 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D410791at33208
OrthoFinder 1 1.000 - - FOG0001484
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103318
Panther 1 1.100 - - O PTHR12400
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1215
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.