DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and Ip6k1

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_038813.2 Gene:Ip6k1 / 27399 MGIID:1351633 Length:433 Species:Mus musculus


Alignment Length:426 Identity:84/426 - (19%)
Similarity:156/426 - (36%) Gaps:172/426 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VEQQQQQQQQQQSNNNNERIPNENCDYLSLQRSGQAPKNHIQAQDPAQMSLLKFLAINALELSAP 140
            |||....:::|....::.|         ||.|||.. .:|  .::.|.:|               
Mouse   102 VEQDDTPEREQPRRKHSRR---------SLHRSGSG-SDH--KEEKASLS--------------- 139

  Fly   141 ATPHLLQHQQAHKQAK-PQGWMQLSGH---PESIVPTSTGIVRKRISGLEDSEVHAYRLICKEPQ 201
                 .:..::.::|| |:  ::|..|   |..::.:::|:..::||      .:.:.|.|.:.|
Mouse   140 -----FETSESSQEAKSPK--VELHSHSDVPFQMLDSNSGLSSEKIS------YNPWSLRCHKQQ 191

  Fly   202 TAQIVPAYFGIQEMQSQ-------HFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDL 259
                      :..|:|:       .|:.|::::..|:.|||:|:|||:|                
Mouse   192 ----------LSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTR---------------- 230

  Fly   260 YQKMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKT----C 320
                   ..|....||..||.:.|...       |:|.:.|.|:..::      |..|.|    |
Mouse   231 -------QHGDDASAEKAARQMRKCEQ-------STSATLGVRVCGMQ------VYQLDTGHYLC 275

  Fly   321 R--------SSEQIAQTIEQF----LAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFI 373
            |        |.|.....:.|:    |..||.:.:.:|.:|:.::.|:|:.   ||:....||:.:
Mouse   276 RNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQ---ASYRFYSSSLLV 337

  Fly   374 VYDDDRVGVWLIDFAKCR-------------ELPP-----------------------HVR-VDH 401
            :||.          .:||             |:||                       .|| :|.
Mouse   338 IYDG----------KECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDF 392

  Fly   402 RSAWAPGNREE---------GLLRGMDELIRSFEEV 428
            ..:...|.|::         |.:.|::.||...|::
Mouse   393 AHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQM 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 56/267 (21%)
Ip6k1NP_038813.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..160 17/91 (19%)
IPK 207..426 CDD:281727 56/267 (21%)
Substrate binding. /evidence=ECO:0000250 220..228 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..383 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.