DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and Ip6k3

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_766615.1 Gene:Ip6k3 / 271424 MGIID:3045325 Length:396 Species:Mus musculus


Alignment Length:387 Identity:80/387 - (20%)
Similarity:131/387 - (33%) Gaps:143/387 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QQQQSNNNNERIPNENCDYLSLQRSGQAPKNHIQAQDPAQMSLLKFLAINALELSAPATPHLLQH 148
            |..|....:|..|   |....|.||             .:.|..|.|..:...||..|:|  |..
Mouse   108 QTLQQTTGSESSP---CPLTQLARS-------------LKESAAKVLLRSDCHLSTQASP--LVE 154

  Fly   149 QQAHKQAKPQG---WMQLSGHPESIVPTSTGIVRKRISGLEDSEVHAYRLICKEPQTAQIVPAYF 210
            .:...|.:.:|   |                       ||...:.|..||..:.|          
Mouse   155 SEDGSQVERKGFNPW-----------------------GLHCHQAHLTRLCSQYP---------- 186

  Fly   211 GIQEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDLYQKMIAVDAGAPTPAE 275
               |.:...|:.|:::::.::.||::|:|||:|                       ..|.....|
Mouse   187 ---EDKRHRFLLLENVVSQYKQPCILDLKMGTR-----------------------QHGDDASEE 225

  Fly   276 HEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKT--CR--------SSEQIAQTI 330
            .:||.:.|.       :.|:|...|.||..:::.    ..|.|:  |:        |.|...|.:
Mouse   226 KKARHMKKC-------AQSTSACLGVRICGMQVY----QTDQKSFLCKDKYYGRKLSVEGFRQAL 279

  Fly   331 EQFL----AARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDD------------- 378
            .|||    ..|..:.:.:|:||:.:..||...   :|:....||:.|:||.:             
Mouse   280 SQFLHDGTRLRAELLEPILRRLQALLTVIRSQ---SSYRFYSSSVLIIYDGEPPQTTQGSTSGGV 341

  Fly   379 ------RVGVWLIDFAKCRELPPHVRVDHRSAWAPGNREE----GLLRGMDELI---RSFEE 427
                  :|.|.:||||         ....:.:|......|    |.:.|::.||   |..:|
Mouse   342 TSGDPAKVDVRMIDFA---------HTTFKGSWNEHTTYEGPDPGYIFGLENLIGILRDIQE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 53/245 (22%)
Ip6k3NP_766615.1 IPK 193..390 CDD:281727 52/242 (21%)
Substrate binding. /evidence=ECO:0000250 206..214 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.