DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and SPAC607.04

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_593593.1 Gene:SPAC607.04 / 2543061 PomBaseID:SPAC607.04 Length:268 Species:Schizosaccharomyces pombe


Alignment Length:301 Identity:65/301 - (21%)
Similarity:104/301 - (34%) Gaps:85/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 QLSGHPESIVPTSTGIVRKRISGLEDSEVHAYRLICKEPQTA-QIVPAYFGIQEMQSQHFIE--- 222
            |.:||.:.:|.....|:   |.....|||..|: .|.:..|. ..:|..|| :.|.|...||   
pombe     9 QAAGHGQVLVSEDDKIL---IKPCIKSEVDFYK-TCNDNITLYNWIPKNFG-EWMPSSRDIEGIN 68

  Fly   223 ----------------LQDLLAGFRDPCVMDIKMGSRTFLESEVSNATLRPDLYQKMIAVDAGAP 271
                            |:::|.....|||||||:|.:.:.:.                     ||
pombe    69 PIAESVAFSLTGKAIILENILYQMETPCVMDIKLGKQLWADD---------------------AP 112

  Fly   272 TPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDL-------KTCRSSEQIAQT 329
            ........|:::         .::|.|.||||..:....|.....:       ||...|:.:...
pombe   113 LEKRKRLDAVSR---------STTSGSLGFRITGILSWDRTNNTYIKRSTAWGKTLTDSDVVEGL 168

  Fly   330 IEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYD----------DDRVGVWL 384
            .:.|::...|.:..|::...::..:.|.....:..|:..|||..|||          :..|.:.|
pombe   169 NDFFVSCSLSQKARLVESFLNLLKLFEVDLSESYIELKSSSILFVYDYSSLNPTYHCESNVVLKL 233

  Fly   385 IDFAKCRELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSF 425
            ||.|             .|.|.....:...|.|:..||..|
pombe   234 IDLA-------------HSRWTKNTIDHNTLIGVKNLIHCF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 48/242 (20%)
SPAC607.04NP_593593.1 IPK 83..261 CDD:281727 45/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.