DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K1 and IP6K3

DIOPT Version :9

Sequence 1:NP_609313.2 Gene:IP3K1 / 34300 FlyBaseID:FBgn0032147 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001136355.1 Gene:IP6K3 / 117283 HGNCID:17269 Length:410 Species:Homo sapiens


Alignment Length:373 Identity:73/373 - (19%)
Similarity:140/373 - (37%) Gaps:117/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QAQDPAQMS-----------LLKFLAINALELSAPATPHLLQHQQAHKQAKPQGWMQLSGHPE-- 168
            ::|:|.::|           |.:....|..:.:....|| .|..::.|::..:..::...|..  
Human    90 ESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPH-AQLARSPKESPAKALLRSEPHLNTP 153

  Fly   169 --SIVPTSTG--IVRKRIS--GLEDSEVHAYRLICKEPQTAQIVPAYFGIQEMQSQHFIELQDLL 227
              |:|..:.|  :.||..:  ||:..:.|..||..:.|             |.:...|:.|::::
Human   154 AFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYP-------------ENKRHRFLLLENVV 205

  Fly   228 AGFRDPCVMDIKMGSRTFLESEVSNATLRPDLYQKMIAVDAGAPTPAEHEARAITKLRYMTFRES 292
            :.:..|||:|:|||:|                       ..|.....|.:||.:.|.       :
Human   206 SQYTHPCVLDLKMGTR-----------------------QHGDDASEEKKARHMRKC-------A 240

  Fly   293 LSSSHSKGFRIEALRLRGRPPVKDLKTCR--------SSEQIAQTIEQFLAARRSVQKELLKRLK 349
            .|:|...|.||..:::....  |....|:        |.|...|.:.|||.....:::|||:.:.
Human   241 QSTSACLGVRICGMQVYQTD--KKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLEPIL 303

  Fly   350 H-MRLVIEQSTFFASHEIIGSSIFIVYDDD----------------------------RVGVWLI 385
            | :|.::......:|:....||:.::||..                            :|.:.:|
Human   304 HQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMI 368

  Fly   386 DFAKCRELPPHVRV-----DHRSAWAPGNREEGLLRGMDELIRSFEEV 428
            |||       |...     :|.:...|   :.|.:.|::.|||..:::
Human   369 DFA-------HTTYKGYWNEHTTYDGP---DPGYIFGLENLIRILQDI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K1NP_609313.2 IPK 220..426 CDD:281727 51/247 (21%)
IP6K3NP_001136355.1 IPK 198..404 CDD:309046 51/247 (21%)
Substrate binding. /evidence=ECO:0000250 211..219 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..358 0/24 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.