DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and SCNN1D

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001123885.2 Gene:SCNN1D / 6339 HGNCID:10601 Length:802 Species:Homo sapiens


Alignment Length:561 Identity:89/561 - (15%)
Similarity:174/561 - (31%) Gaps:205/561 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLPKFLGFLQARNDDGLCKRKTGFE----IYCEMASIHGFHIFVGAK--TWQRILWWLLICNA-V 127
            |.||      ..:.:||.:....|.    .:|..|:|||....|.::  ..:...|.||...| |
Human   203 PPPK------EGHQEGLVELPASFRELLTFFCTNATIHGAIRLVCSRGNRLKTTSWGLLSLGALV 261

  Fly   128 LLSFTL-----------VIMSLSMSKETPTIRFIDTMMKPTAEVPFPAVTICGFNTKEWMNSSQI 181
            .|.:.|           |:|::|:..|...:               |.||:|..|.:   ..|.:
Human   262 ALCWQLGLLFERHWHRPVLMAVSVHSERKLL---------------PLVTLCDGNPR---RPSPV 308

  Fly   182 VNQRNASWLELLEDLA---LPICPQIKICQWDNRMVNCLDQLQPIWTLDQ--------------- 228
            :..     ||||::.|   :.....:.:.:....:...:.:.:|.:.||:               
Human   309 LRH-----LELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVR 368

  Fly   229 ---RLC----------------------------------------------------CSFN--- 235
               |||                                                    ||::   
Human   369 VGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLD 433

  Fly   236 ---------YNKQLFSSYL--------------GVSFVLRSNDE--ILQSSKSAGFEVLIHESHE 275
                     ::....|.|.              ||..|||...:  :...|..||..|::|..:.
Human   434 CQARQFRTFHHPTYGSCYTVDGVWTAQRPGITHGVGLVLRVEQQPHLPLLSTLAGIRVMVHGRNH 498

  Fly   276 IP---------NGATPRVFVPGESDAHIMLRPYINRFTKNLKGLSLQKRGCYFSTERRLILSDVY 331
            .|         ...|.......|.:.|.:..|| ...|...:|:.::           |:.:..|
Human   499 TPFLGHHSFSVRPGTEATISIREDEVHRLGSPY-GHCTAGGEGVEVE-----------LLHNTSY 551

  Fly   332 NQINCLAECRTESILKSCGC------IPP-----KSPIEKSWLICDLKQMQCVIDFDHDEIISGE 385
            .:..||..|..:.::::|.|      :|.     .|....:|..|..:..|   |.:...:....
Human   552 TRQACLVSCFQQLMVETCSCGYYLHPLPAGAEYCSSARHPAWGHCFYRLYQ---DLETHRLPCTS 613

  Fly   386 QKNCDCLPPCEFNRYEFQSDIR----------FIKGMINNSIVNTSNQETTNEVRVRVYYDS--- 437
            :    |..||..:.::..:...          .:..:....:.:.|:::.::..::.:.|..   
Human   614 R----CPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNY 674

  Fly   438 -AIAEELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELI 477
             ::.|..:..|.:    .:...|.:..|:.|.|.:|:.||:
Human   675 RSVEEAPVYSVPQ----LLSAMGSLCSLWFGASVLSLLELL 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
SCNN1DNP_001123885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..211 3/13 (23%)
ENaC 219..784 CDD:273304 84/539 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.