DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and ASIC5

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:531 Identity:112/531 - (21%)
Similarity:192/531 - (36%) Gaps:168/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LKRLKILRWYNRVSKRFEEFPLPKFLGFLQARNDDGLCKRKTGFEIYCEMASIHGFHIFVGAKTW 114
            |:::|:.     :||:    |||            ...:||.....:....|.||.|..|..::.
Human    16 LEKIKLC-----LSKK----PLP------------SPTERKKFDHDFAISTSFHGIHNIVQNRSK 59

  Fly   115 QRILWWLLICNAVLLSFTLVIMSLSMSKETPTIRFIDTMMKPTA---------EVPFPAVTICGF 170
            .|.:.||::   ||.|.:||...:       .||.::....||.         ::.|||||.|..
Human    60 IRRVLWLVV---VLGSVSLVTWQI-------YIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNL 114

  Fly   171 NTKE-------------WMNSSQIV--------------------NQRNASWLELLEDLALPICP 202
            |..:             |...|:::                    :.:|.|.:|.:.:....:..
Human   115 NRFQTDAVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNN 179

  Fly   203 QIKI-CQWDNRMVNCLDQLQPIWTLDQRLCCSFNYNKQLFS------SYLGVSFVLRSNDEILQS 260
            ...: |::..:..:..| ...::| :...|.:||:.:.|.:      |..|:|.:...|.|....
Human   180 STLLDCEFFGKPCSPKD-FAHVFT-EYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTD 242

  Fly   261 SKSAGFE-----VLIHESHEIPNGATPRVFVPGESDAHIMLR---------PYINRFTKNLKGLS 311
            :.:.||.     .:||...::|......:..|....|.:.:|         |: .....|:|   
Human   243 NPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPW-GECNPNIK--- 303

  Fly   312 LQKRGCYFSTERRLILSDVYNQINCLAECRTESILKSCGCIP---PKSPIEKSWLICDL-KQMQC 372
            ||.    ||:         |:...||.||:.:.|.|.|||:|   |...||     ||| |...|
Human   304 LQN----FSS---------YSTSGCLKECKAQHIKKQCGCVPFLLPGYGIE-----CDLQKYFSC 350

  Fly   373 VID-FDHDE---IISGEQKNCDCLPPCE---------FNRYEFQSDIRFIKGMINNSIVNTSNQE 424
            |.. .||.|   :.:....|..|...||         ::.:..|..::::...:|.|    ....
Human   351 VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQS----RKYI 411

  Fly   425 TTNEVRVRVYYD-----------SAIAEELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELI- 477
            ..|.|::.:.|.           :....|||.|:           ||..|||.|.|.:::.|:| 
Human   412 RENLVKIEINYSDLNYKITQQQKAVSVSELLADL-----------GGQLGLFCGASLITIIEIIE 465

  Fly   478 ------FFSCV 482
                  ::.|:
Human   466 YLFTNFYWICI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
ASIC5NP_059115.1 ASC 41..466 CDD:279230 102/473 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.