DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and asic1b

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_999956.1 Gene:asic1b / 407672 ZFINID:ZDB-GENE-040513-1 Length:557 Species:Danio rerio


Alignment Length:458 Identity:99/458 - (21%)
Similarity:184/458 - (40%) Gaps:127/458 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SIHGF-HIFVGAKTW--QRILWWLLICNAVLLSFTLVIMSLSMSKETPTIRFIDTMMKPTAEVPF 162
            |:||. |:||..|.:  ::.||.|:...|:.:....|:..:....:...:..:|.  :....:.|
Zfish    74 SLHGANHVFVEDKKFSIRQGLWALVFLLAISMFLLQVVDRVIYYLQYDYVTLLDE--RNAKNMTF 136

  Fly   163 PAVTICGFNTKEWMNSSQIVNQRNASWLELL---------EDLA--LPICPQ-------IKICQW 209
            ||:|:|.:||   ...||:      |:.:||         :::|  :|:.|:       ..:.::
Zfish   137 PAITLCNYNT---FRRSQL------SYSDLLFMGPLLGYEDNMAPGIPLAPEPDRQGSRFSLAEF 192

  Fly   210 DNRMVNCLDQLQPIWTLDQRLCCSF-------NYNKQLFSSYLGVSFVLRSNDE---ILQSSKSA 264
            .||..:.:|        |..|.|:|       .:.:::|:.| |..:...|..:   :|.::|..
Zfish   193 FNRTRHRMD--------DMLLECNFAGKECGAEHWREIFTRY-GKCYTFNSGQDGRPLLITTKGG 248

  Fly   265 ---GFEVL--IHESHEIPNGATPRVFVPGESD-----AHIMLR-------PYINRFTKNLKGLSL 312
               |.|::  |.:...:|        |.||:|     |.|.::       |:|::.     |..:
Zfish   249 MGNGLEIMLDIQQDEYLP--------VWGETDETTFEAGIKVQIHTQDEPPFIDQL-----GFGV 300

  Fly   313 QKRGCYFST-----ERRL--------------ILSDVYNQIN---CLAECRTESILKSCGC---- 351
            ...   |.|     |:||              |.||.:|..:   |..:|.|..::::|.|    
Zfish   301 APG---FQTFVSCQEQRLTYLPPPWGDCKATPIDSDFFNTYSITACRIDCETRYLVENCNCRMVH 362

  Fly   352 IPPKSPIEKSWLICDLKQMQCVIDFDHDEIISGEQKNCDCLPPCEFNRYEFQSDIRFIKGMINNS 416
            :|..:|      .|..:|.:...|...|.::..:...|.|..||...||  ..::.|::.....|
Zfish   363 MPGDAP------YCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRY--GKELSFVRIPSKAS 419

  Fly   417 I------VNTSNQETTNEVRVRVYYDSAIAEELL--LDVYENWLTFIGTFGGITGLFMGCSFVSV 473
            .      .|.:.|..::.:.|...:..|:..|.:  ...|| ....:|..||..|||:|.|.:::
Zfish   420 AKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKAYE-LAGLLGDIGGQMGLFIGASILTI 483

  Fly   474 FEL 476
            .||
Zfish   484 LEL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
asic1bNP_999956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
ASC 66..548 CDD:295594 99/458 (22%)
Selectivity filter. /evidence=ECO:0000305 477..479 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.