DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and ASIC2

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:495 Identity:102/495 - (20%)
Similarity:168/495 - (33%) Gaps:175/495 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ASIHGFHIFVGAKT------WQRILWWLLICNA--VLLSFT--LVIMSLSMSKETPTIRFIDTMM 154
            |.:||.......:|      .:|.||.|..|.:  :|||::  .::..||....|...|      
Human    64 AKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSFGLLLSWSSNRLLYWLSFPSHTRVHR------ 122

  Fly   155 KPTAEVPFPAVTICGFNTKEWMNSSQ------------IVNQRNA---------------SWLEL 192
            :.:.::||||||:|..|...:...|:            ::..|.|               .|...
Human   123 EWSRQLPFPAVTVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQWFRK 187

  Fly   193 LEDLALPICPQ----IKICQWDNRMVNCLDQLQPIWTLDQRLCCSFNYNKQLFSSYLGVSFVLRS 253
            |.|..|.:.|:    |.....| |:.:.|:.:.........||...|:: .:|:.| |..::..|
Human   188 LADFRLFLPPRHFEGISAAFMD-RLGHQLEDMLLSCKYRGELCGPHNFS-SVFTKY-GKCYMFNS 249

  Fly   254 --------------------------NDEIL-------QSSKSAGFEVLIHESHEIP------NG 279
                                      .||.|       :::..||.:|.||...|.|      .|
Human   250 GEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFG 314

  Fly   280 ATP--RVFVPGESDAHIMLRPYINRFTKNLKGLSLQKRGCYFSTERRLILSDVYNQINCLAECRT 342
            ..|  :.||..:......|.|               ..|...|:|..|....||:...|..:|.|
Human   315 VAPGFQTFVATQEQRLTYLPP---------------PWGECRSSEMGLDFFPVYSITACRIDCET 364

  Fly   343 ESILKSCGC----IPPKSPIEKSWLICDLKQMQCVIDFDHDE-------IISGEQKN-CDCLPPC 395
            ..|:::|.|    :|..:|      .|..:|        |.|       :::.:..| |.|..||
Human   365 RYIVENCNCRMVHMPGDAP------FCTPEQ--------HKECAEPALGLLAEKDSNYCLCRTPC 415

  Fly   396 EFNRYE---------FQSDIRFIKGMINNSIVNTSNQETTNEVRVRVYYDSAIAEELL-LDVYEN 450
            ...||.         .::..::::...|.|                   :..|:|.:| ||::..
Human   416 NLTRYNKELSMVKIPSKTSAKYLEKKFNKS-------------------EKYISENILVLDIFFE 461

  Fly   451 WLTF--------------IGTFGGITGLFMGCSFVSVFEL 476
            .|.:              :|..||..|||:|.|.:::.||
Human   462 ALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILEL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 102/495 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.