DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and ppk6

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster


Alignment Length:513 Identity:114/513 - (22%)
Similarity:188/513 - (36%) Gaps:145/513 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RNDDGLCKRKTG-------------FEIYCEMASIHGFHIFVGAKTW--QRILWWLLICNAVLLS 130
            :|..|...||.|             |..|.|...:.|..:....:|:  .|.:|..::...:|||
  Fly    13 KNSKGDGSRKRGKDPSLIRTAILATFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLS 77

  Fly   131 FTLVIMSLSMSKETPTIRFIDTMMKPTAEVPFPAVTIC--------------------------- 168
            ..|.::........|.:..|...:..| :|.||.||||                           
  Fly    78 IYLTLLLWLKFYSYPILNTISNDLSIT-DVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAE 141

  Fly   169 ---GFNTKEWMN-----------------SSQIVNQRNAS-WLELLEDLALPICP----QIKICQ 208
               ||   :::|                 :..::...|.| |     :.|:.:.|    .:|.|.
  Fly   142 VIAGF---DFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIW-----EAAMAVSPGCFDYVKRCF 198

  Fly   209 WDNRMVNCLDQ------------LQPIWTLDQRLCCSFNYNKQ----------LFSSYLGVSFVL 251
            |.:....|...            |.|        |||||||.:          :|....|::||.
  Fly   199 WGHTEFQCNQSHEYLSFIPTTAYLGP--------CCSFNYNPRNASFVPFSANIFGMDGGLTFVG 255

  Fly   252 RSNDEILQSSKSAGFEVLIHESHEIPNGATPRVFVPGESDAHIMLRPYINRFTKNLKGLSLQKRG 316
            ....|   .:.:.|..||:|...:....|...|.:..:|::.:.:.|.:...:..:..||.:||.
  Fly   256 AEGSE---RNLNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRD 317

  Fly   317 CYFSTERRLILSDVYNQINCLAECRTESILKSCGCIPPKSPI-EKSWLICDLKQMQCV-IDFDHD 379
            |..|.:  |.||: |.|..||..|:||:|:|.|||.|...|| ...:..|:|....|. .::|:.
  Fly   318 CLISGD--LQLSN-YRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNLNDTFCYSANYDNF 379

  Fly   380 EIISGEQKNCD-CLPPC------------EFNRYEFQSDIRFIKGMINN-SIVNTSNQETTNEVR 430
            :.:     .|| |||.|            :.|::::.....:...::|| |.|            
  Fly   380 KSV-----RCDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFV------------ 427

  Fly   431 VRVYYDSAIAEELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELIFFSCVRPTCNW 488
            :|||....:...:......:|:..:...|||..|.:|.|.:||.|..::...|...|:
  Fly   428 LRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYCTYRLYINY 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
ppk6NP_611461.3 ASC 85..476 CDD:279230 96/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.