DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and F58G6.8

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:122 Identity:31/122 - (25%)
Similarity:50/122 - (40%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KRFEEFPLPKFLGFLQARNDDGLCKRKTGFEIYCEMASIHGFHIFVGAKTWQRILWW--LLICNA 126
            |..:|.|..:::.|            |...:.:.|.|:|||......|.|...|:.|  :||.:|
 Worm    40 KLHDETPDTRWIQF------------KNHLKNWGETATIHGVPHMAQAHTVIAIIVWSIILIVSA 92

  Fly   127 VLLSFTLVIMSLSMSKETPTIRFIDTMMKPTAEVPFPAVTICGFNTKEWMNSSQIVN 183
            |    ..|.|..|::........:..:.......|||::|.|  ||..: ..|::||
 Worm    93 V----AFVYMFYSIAASYLAFNVVVNLNTGLDSEPFPSITFC--NTNPY-KLSEMVN 142



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.