DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and ppk23

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:557 Identity:115/557 - (20%)
Similarity:197/557 - (35%) Gaps:188/557 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YCEMASIHGFHIFV--GAKTWQRILWWLLICNAVLLSFT--LVIMSLSMSKET-PTIRFIDTMMK 155
            :.:.:::||.....  |....::.:|:   |...:.:.|  ::||||....:| |||..:||...
  Fly    34 FFQNSTLHGVRYIAESGRPIGEKFMWF---CFTSIGAVTALVIIMSLWEKFQTNPTITGLDTDFH 95

  Fly   156 PTAEVPFPAVTICG-------------FNTKEWMNSSQIVNQRNASWLELLEDL----------- 196
             ...|.||...:|.             :||  ..|..:...|....:|.:|..|           
  Fly    96 -NQNVVFPTTVVCPEAAFDHDKTYEKVYNT--LANYDEAQAQMYTPFLRILTSLNFENVRDAKVL 157

  Fly   197 --ALP------------------ICPQIKI-CQWDNRMVNCLDQLQPIWTLDQRLCCSFNYNKQL 240
              ::|                  .|..:.: |::.:..:.|.|..:||:| :...|.:||..   
  Fly   158 SQSIPQNLLDAHTIREWAFEGHIDCKNVFVSCKYRDEDIPCCDHFEPIYT-EHGFCYAFNSR--- 218

  Fly   241 FSSYLGVSFVLRSNDEILQSSKSAGFEVLIHESHE---------IPNGATPRVFVPGE-----SD 291
                    |.....:::...:.        |:.:|         ||| :|.|:|:...     ||
  Fly   219 --------FKSTPTEDVKTGAP--------HDLYETDKKWALFFIPN-STSRIFIFSNEEYFGSD 266

  Fly   292 AHIML---RPYI--------NRF-TKNLKGLSLQKRGCYFSTERRL-ILSDVYNQINCLAECRTE 343
            .:..:   .|.:        |.: |.:.:.||:.:|.|.||.|.:| ...|.|...:|:.:||..
  Fly   267 FNAQIDWSEPQLVEVRISKKNTYTTDDARQLSIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMN 331

  Fly   344 SILKSCGCIPP-KSPI-EKSWLI-----------------------CDLKQMQCVIDFDHDEIIS 383
            ..:|.|.|.|| ..|| |.|.:|                       |.:|...|:     ||..|
  Fly   332 KAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDFDCL-----DEFKS 391

  Fly   384 GEQKNCDCLPPCEFNRYEFQSDIRFIKGMIN-NSIVNTSNQETTNEVRVR------VYYDSAIAE 441
            ......|||          |.::...|.:.| :.::..|::..:..|.|.      :.|..    
  Fly   392 NITNIKDCL----------QCELSCSKTVFNIDKLIKMSDRPESLGVLVEFLTWPIIRYKR---- 442

  Fly   442 ELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELIFFSCVRPTCNWLTRQQILWR--------- 497
                :|...|:..:.:||||..||:|.|.:|..|:|::..:|..|.....:|.|:.         
  Fly   443 ----EVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRACCMVYKNRQELYEIEEKIRQEP 503

  Fly   498 ----------RRRNQRVGITES----------RSLGP 514
                      :..|.|:|.|.:          .|.||
  Fly   504 PPKIDLKLSLKSHNPRIGDTPTSAVLKVKPAEESAGP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
ppk23NP_001097011.1 ASC 34..476 CDD:279230 104/491 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.