DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and Scnn1a

DIOPT Version :10

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_035454.3 Gene:Scnn1a / 20276 MGIID:101782 Length:699 Species:Mus musculus


Alignment Length:132 Identity:23/132 - (17%)
Similarity:41/132 - (31%) Gaps:62/132 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NLFNELF------LDRPFPQSNRVGSYYDRKPRMWYALN----------------HKGSMVRPNG 63
            |.|..:|      :||.....:.:.|...|||::..|.|                :.|.:.:..|
Mouse   130 NQFTSIFCLMVMSIDRYLAVVHPMKSIKWRKPQVAKATNVAVWVVSLLVILPVVFYSGLITKAEG 194

  Fly    64 --------DDKGAAR---------------------------VKPRGTGVFLPERPVSSSQEKLN 93
                    |.:||.:                           :|.:.:|:     .||||:.:.:
Mouse   195 CFCSIVWPDPQGAYQTAFMIYTFLLGFFLPLMVICLCYLLIIIKVKSSGI-----KVSSSKRRYS 254

  Fly    94 NK 95
            .|
Mouse   255 EK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 ASC 96..479 CDD:459966 23/132 (17%)
Scnn1aNP_035454.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
ENaC 79..676 CDD:273304 23/132 (17%)
Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000305|PubMed:18650438 200..270 10/62 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..244 1/32 (3%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..699
PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P37088 669..673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.