DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and asic-1

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_491214.3 Gene:asic-1 / 191422 WormBaseID:WBGene00022815 Length:823 Species:Caenorhabditis elegans


Alignment Length:301 Identity:69/301 - (22%)
Similarity:120/301 - (39%) Gaps:43/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 CQWDNRMVNC----LDQLQPIW----TLDQRLCCSFNYNKQLFSSYLGVSFVLRSN-DEILQSSK 262
            |.::.|..|.    ::.|.|.:    |..|:|  ..|.|::...:| |:...:..| .|.|.:::
 Worm   494 CSFNGRECNVKHDFVEYLDPTYGACFTYGQKL--GNNTNERSGPAY-GLRLEVFVNVTEYLPTTE 555

  Fly   263 SAGFEVLIHESHEIPNGATPRVFVPGESDAHIMLRPYINRFTKNLKGL--------SLQKRGCYF 319
            :||..:.:|.:.|.|...|.....|         ..:::.|...||.:        ...:.|   
 Worm   556 AAGVRLTVHATDEQPFPDTLGFSAP---------TGFVSSFGIKLKSMVRLPAPYGDCVREG--- 608

  Fly   320 STERRLILSDVYNQINCLAECRTESILKSCGCIPPKSP---IEKSWLICDLKQMQCVIDFDHDEI 381
            .||..:.....||...|...|..:.:.|:|||..|:.|   ..|:..:.|..:.:|:.:..|...
 Worm   609 KTEDFIYTQKAYNTEGCQRSCIQKHLSKTCGCGDPRFPPYRESKNCPVDDPYKRECIKNEMHVAT 673

  Fly   382 ISGEQKNCDCLPPCEFNRYEFQ-SDIRF--IKGMINNSIVNTSNQETTNEVR-----VRVYYDSA 438
            ...::..|.|..||..:.|... |..|:  |.|.::...:..:.....|..|     :.||::..
 Worm   674 RDSKKLGCSCKQPCNQDVYSVSYSASRWPAIAGDLSGCPLGMAAHHCLNYKREQGSMIEVYFEQL 738

  Fly   439 IAEELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELIFF 479
            ..|.||......|...:..|||..||:||.|.:::.|:..|
 Worm   739 NYESLLESEAYGWSNLLSDFGGQLGLWMGVSVITIGEVACF 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
asic-1NP_491214.3 deg-1 16..779 CDD:273309 68/299 (23%)
ASC 17..>104 CDD:279230
ASC <469..788 CDD:295594 69/301 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.