DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and mec-4

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:278 Identity:61/278 - (21%)
Similarity:108/278 - (38%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 CCSFNYNK--QLFSSYLGVSFVLR-----SNDEILQSSKSAGFEVLIHESHEIPNGATPRVFVPG 288
            |.:||:|:  .|.|...|..:.||     :..:.:.::::.|..:.||:..:.|...|.....| 
 Worm   474 CFTFNHNRTVNLTSIRAGPMYGLRMLVYVNASDYMPTTEATGVRLTIHDKEDFPFPDTFGYSAP- 537

  Fly   289 ESDAHIMLRPYINRFTKNLKGLSLQKRG--------CY--FSTERRLILSDVYNQINCLAECRTE 343
                    ..|::.|     ||.|:|..        |.  ..|...:..:..|:...|...|..:
 Worm   538 --------TGYVSSF-----GLRLRKMSRLPAPYGDCVPDGKTSDYIYSNYEYSVEGCYRSCFQQ 589

  Fly   344 SILKSCGCIPPKSPIEKSWLICDLKQ---MQCVIDFDHDEI--ISGEQKNCDCLPPCEFNRYEF- 402
            .:||.|.|..|:.|:.::...||...   .:| :|...:::  :.|..: |.|..||..:.|.. 
 Worm   590 LVLKECRCGDPRFPVPENARHCDAADPIARKC-LDARMNDLGGLHGSFR-CRCQQPCRQSIYSVT 652

  Fly   403 -------QSDIRFIKGMINNSIVNTSNQETTNEVRVRVYYDSAIAEELLLDVYENWLTFIGTFGG 460
                   ...::...|..|.:.|..:.....|...|.|:|:....|.|.......::..:..|||
 Worm   653 YSPAKWPSLSLQIQLGSCNGTAVECNKHYKENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGG 717

  Fly   461 ITGLFMGCSFVSVFELIF 478
            ..||:.|.||::..|.:|
 Worm   718 QLGLWCGISFLTCCEFVF 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
mec-4NP_510712.2 deg-1 86..736 CDD:273309 61/278 (22%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 61/278 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I3369
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.