DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and mec-10

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_509438.1 Gene:mec-10 / 181101 WormBaseID:WBGene00003174 Length:724 Species:Caenorhabditis elegans


Alignment Length:315 Identity:75/315 - (23%)
Similarity:120/315 - (38%) Gaps:73/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 CCSFNYNKQLFSSYL--GVSFVLR-----SNDEILQSSKSAGFEVLIHESHEIPNGATPRVFVPG 288
            |..||:::::|.|.:  |..:.||     :..:.|.:|::.|..:.||:..:.|...|.....| 
 Worm   434 CFVFNHDREIFKSSVRAGPQYGLRVMLFVNASDYLPTSEAVGIRLTIHDKDDFPFPDTFGYSAP- 497

  Fly   289 ESDAHIMLRPYINRFTKNLKGLSLQK-----------------RGCYFSTERRLILSDVYNQINC 336
                    ..||:.|...:|.:|...                 :|..:|||            .|
 Worm   498 --------TGYISSFGMRMKKMSRLPAPYGDCVEDGATSNYIYKGYAYSTE------------GC 542

  Fly   337 LAECRTESILKSCGCIPPKSPIEKSWLICDL---KQMQCVIDFDHDEI--ISGEQKNCDCLPPCE 396
            ...|..|.|:..|||..|:.|.......|.:   ...:|:....| :|  |.|..| |.|..||.
 Worm   543 YRTCFQELIIDRCGCSDPRFPSIGGVQPCQVFNKNHRECLEKHTH-QIGEIHGSFK-CRCQQPCN 605

  Fly   397 FNRYEFQ-SDIRFIKGMINNSI------VNTSNQE-TTNEVRVRVYYDSAIAEELLLDVYENWLT 453
            ...|... |:..:....:|.|:      ....|:| ..|...:.|:|::...|.|........:.
 Worm   606 QTIYTTSYSEAIWPSQALNISLGQCEKEAEECNEEYKENAAMLEVFYEALNFEVLSESEAYGIVK 670

  Fly   454 FIGTFGGITGLFMG------CSFVSV-FELIFFSCVRPTCNWLTRQQILWRRRRN 501
            .:..|||..||:.|      |.||.: ||||:.:    ..:.:.:|:|  |||.|
 Worm   671 MMADFGGHLGLWSGVSVMTCCEFVCLAFELIYMA----IAHHINQQRI--RRREN 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
mec-10NP_509438.1 ASC 88..723 CDD:295594 75/315 (24%)
deg-1 99..696 CDD:273309 65/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I3369
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.