DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk11 and del-6

DIOPT Version :9

Sequence 1:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:363 Identity:71/363 - (19%)
Similarity:125/363 - (34%) Gaps:115/363 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 KEWMNSSQIVNQRNASWLELLEDLALPI----CPQIKICQWDNRMVNCLDQLQPIWTLDQRLCCS 233
            |:|.:   |::.|..::.|..:...:.:    ..:.:...:|:.......:|:..|....::|..
 Worm   183 KKWRD---ILDSRGITFDEFTQKTGIEVLRRSMQRFRRRTFDDDETVIKTKLRISWISQMQICFQ 244

  Fly   234 FNYNKQLFSSY--LGVSF--VLRSNDEILQSSK----SAGF-----------------------E 267
            ..:::..|.:.  .||.|  :|..|.|..:..|    |..|                       |
 Worm   245 PEFDQDNFKTIDDQGVFFDMLLSHNAENTEGQKIDCMSVDFHGRPSSLNRFMEGKGRSRDGYVDE 309

  Fly   268 VLIHESHEIPNGATPRVFVPGESDAHIMLRPYINRFTKNLKGLSLQKRGCYFSTERRLILSDVYN 332
            |.:.:.||:              .||:         |...:.|...::|    |..|.:.....:
 Worm   310 VCLGQRHEV--------------TAHV---------TALYQMLENDEQG----TRCRDVEDGEDS 347

  Fly   333 QINCLAECRTESILKSCGCIPPKSPIEKSWL----------ICDLKQMQCVIDFDHDEIISGEQK 387
            :.||.:.||.|.|..:|.|    :|:..|:|          :||  ..||.:|.........|..
 Worm   348 EFNCRSRCRMEMIRDACHC----TPLSLSYLAKKEDMEIFPLCD--YTQCTVDVQKGNYSDTECA 406

  Fly   388 NCDCLPPCEFNRYEFQSDIRFIKGMINNSIVNTSNQETTNEVRVRVYYDSAIAEEL------LLD 446
            | .|.|.|.        .|||               |..:.|:.|:........||      .|.
 Worm   407 N-KCFPDCR--------QIRF---------------EVDHSVKGRMLRPDLTLVELSWGPFEYLT 447

  Fly   447 VYENW----LTFIGTFGGITGLFMGCSFVSVFELIFFS 480
            :.:.|    .:||...||..|:::|.|.:|:.:|:.:|
 Worm   448 MEQQWKYSATSFIAALGGSIGMWLGLSILSLIQLVTYS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk11NP_001334672.1 None
del-6NP_741622.2 ASC <347..484 CDD:295594 40/166 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.