DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NANOS3 and nanos

DIOPT Version :10

Sequence 1:NP_001092092.1 Gene:NANOS3 / 342977 HGNCID:22048 Length:192 Species:Homo sapiens
Sequence 2:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster


Alignment Length:69 Identity:32/69 - (46%)
Similarity:42/69 - (60%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    61 KDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTR 125
            |..||....:....|.|.||::|.|..|:..||.::|...|||||.||.||||.|||:.:.|||.
  Fly   303 KVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTI 367

Human   126 RFCP 129
            ::||
  Fly   368 KYCP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NANOS3NP_001092092.1 Trypan_PARP <23..74 CDD:368653 3/12 (25%)
zf-nanos 77..130 CDD:461728 28/53 (53%)
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.