DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and AT5G42320

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:325 Identity:78/325 - (24%)
Similarity:132/325 - (40%) Gaps:30/325 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TAYNWAQYYELDDTYAWLQSLAQTNPG--VVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGI 180
            |..||..|:..||....:.||...:|.  .:.||:.|.......:..|...:||:..:.::...|
plant    38 TPINWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRGGKESDDRSNFRI 102

  Fly   181 FLEAGIHAREWIAPAAATFIINQLLTSE--VEN-----IKELAENYTWYVLPHANPDGYVYTHTT 238
            .|..|.|.||.|....| |.|..:|:.|  :.|     :|...:.....::|..||:|.....:.
plant   103 LLTFGQHGRELITSELA-FRILSILSEEQFLPNKNGGILKNTLDKLVIKMVPIENPNGRKRVESG 166

  Fly   239 NRLWRKTRTPYGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGK 303
            :...|:...      |.|.|||||..|.:....... |:...|.:.|||.||..:.|.  .:...
plant   167 DLCERRNGR------GVDLNRNWGVDWGKKEKDYDP-SEENPGTAPFSEPETQIMRKL--AISFD 222

  Fly   304 VQLYLSLHAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNK-----RYGTTYTGGNIYDAIY 363
            ..:::::|:..:.|..||.|.:..|:.:.  .:.....:..:||     |......||::.   |
plant   223 PHIWINVHSGMEALFMPYDHKNITPEGLP--SQKMRTLLEKLNKFHCHDRCMIGSGGGSVG---Y 282

  Fly   364 PAAGASVDWAYGTQDVRMAFCYEL-RPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEVKSLG 427
            .|.|.:.|:.|......|||.:|: ..:.|:....||:.....:|..:.:|:...|....:..||
plant   283 LAHGTATDYIYDVVKAPMAFTFEIYGDNQTASRDCFKMFNPVDLPNFKRVLNDWSAAFFTIFQLG 347

  Fly   428  427
            plant   348  347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 65/269 (24%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 73/312 (23%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 58/235 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.