DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and AGBL2

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:335 Identity:66/335 - (19%)
Similarity:121/335 - (36%) Gaps:108/335 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YELDDTYAWLQSLAQTNP------GVVTLIEGGKTYQGRSILGVKITKGGET-INGKAKPGIFLE 183
            |...|...:|.|:| .||      .:.||.   ::..|.::..:.||...:| ....||..:.|.
Human   398 YTYTDLQCYLLSVA-NNPIQSQFCKLQTLC---RSLAGNTVYLLTITNPSQTPQEAAAKKAVVLS 458

  Fly   184 AGIHARE----WIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRK 244
            |.:|..|    |:......||:     |...:.:.|.:.:.:.|||..||||.:..:     :| 
Human   459 ARVHPGESNGSWVMKGFLDFIL-----SNSPDAQLLRDIFVFKVLPMLNPDGVIVGN-----YR- 512

  Fly   245 TRTPYGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLS 309
                 .|..|.|.||    |:..:...|..|. .|.         ...:.:.:|  :.:|.||..
Human   513 -----CSLAGRDLNR----HYKTILKESFPCI-WYT---------RNMIKRLLE--EREVLLYCD 556

  Fly   310 LHAYS-QYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYP---AAGASV 370
            .|.:| :..::.||..::                   |::|.       :::.::|   ...|..
Human   557 FHGHSRKNNIFLYGCNNN-------------------NRKYW-------LHERVFPLMLCKNAPD 595

  Fly   371 DWAYGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMAT-------------- 421
            .:::.:.:.::..|.|        .||      ::|.....:|:|....:|              
Human   596 KFSFHSCNFKVQKCKE--------GTG------RVVMWRMGILNSYTMESTFGGSTLGNKRDTHF 646

  Fly   422 ---EVKSLGY 428
               ::|||||
Human   647 TIEDLKSLGY 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 53/262 (20%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 61/328 (19%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 64/326 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.