DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and Agbl4

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_011238954.1 Gene:Agbl4 / 78933 MGIID:1918244 Length:552 Species:Mus musculus


Alignment Length:318 Identity:73/318 - (22%)
Similarity:120/318 - (37%) Gaps:73/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RATTAYNWAQYYELDDTYA----WLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGK 175
            |....|.:|..|..  ||.    :|.||.:.|.......:.|::.|.|.:..:.||.......|.
Mouse   168 REDDIYQFAYCYPY--TYTRFQHYLDSLQKKNMDYFFREQLGQSVQQRQLDLLTITSPENLREGS 230

  Fly   176 AKPGIFLEAGIHARE----WIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDG-YVYT 235
            .|..||:...:|..|    ::......|:::|...:.|     |.|:..:.:.|..|||| |:..
Mouse   231 EKKVIFITGRVHPGETPSSFVCQGIIDFLVSQHPIARV-----LREHLVFKIAPMLNPDGVYLGN 290

  Fly   236 HTTNRLWRKTRTPYGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSE-----IETLSLSK 295
            :..            |..|.|.||:|                  ..||.::.     ::.| :.|
Mouse   291 YRC------------SLMGFDLNRHW------------------LDPSPWAHPTLHGVKQL-IIK 324

  Fly   296 FIEGLKGKVQLYLSLHAYSQYLL-YPYGHTSDLPDNVADFEK------VFDASIAAVNKRYGTTY 353
            .....|..::.|:.:||:|..:. :.||       |:.:.|:      :|...:....:.:..|.
Mouse   325 MYNDPKTSLEFYIDIHAHSTMMNGFMYG-------NIFEDEERFQRQSIFPKLLCQNAEDFSYTS 382

  Fly   354 TGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEE 411
            |..| .||:  .||....:..|..| ..::||.|..|..||:.|....|   ||.:||
Mouse   383 TSFN-RDAV--KAGTGRRFLGGLLD-HSSYCYTLEVSFYSYIIGGTTAA---VPYTEE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 59/279 (21%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 70/308 (23%)
Agbl4XP_011238954.1 Pepdidase_M14_N 65..>142 CDD:375499
M14_AGBL4_like 199..450 CDD:349479 63/285 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.