DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and Agbl3

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:324 Identity:65/324 - (20%)
Similarity:116/324 - (35%) Gaps:114/324 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ITKGGETINGKAKPGIFLEAGIHARE----WIAPAAATFIINQLLTSEVENIKELAENYTWYVLP 225
            ||...:|.:.|.| .:.|.|.:|..|    ||......:|:     .:..:.:.|.:.:.:.|:|
Mouse   347 ITTPLKTSDSKRK-AVILTARVHPGETNSSWIMKGFLDYIL-----GDSSDARLLRDTFIFKVVP 405

  Fly   226 HANPDGYVYTHTTNRLWRKTRTPYGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIET 290
            ..||||.:..:     :|      .|..|.|.|||:          :|...:::  ||.:  ...
Mouse   406 MLNPDGVIVGN-----YR------CSLAGRDLNRNY----------TSLLKESF--PSVW--YTR 445

  Fly   291 LSLSKFIEGLKGKVQLYLSLHAYSQ--------------------YL---LYPYGHTSDLPDNVA 332
            ..:::.:|  |.:|.||..||.:|:                    ||   ::|...:.:.|:   
Mouse   446 NMINRLME--KREVILYCDLHGHSRKQNIFMYGCDGSSRSKTKGLYLQQRIFPLMLSKNCPN--- 505

  Fly   333 DFEKVFDASIAAVN---KRYGT------------------TYTGGNIYDAIYPAAGASVDWAYGT 376
                :|..|....|   .:.||                  |:.|..:        |......:||
Mouse   506 ----IFSFSACKFNVQKSKEGTGRVVMWKMGIRNSFTLEATFCGSTL--------GNKRGTHFGT 558

  Fly   377 QDVRMA---FCYEL----RPSSTSYLTGFK--------LPAEQIVPASEELLDSIVAMATEVKS 425
            :|:...   ||..|    .|..:.|....|        |.:|::   |:....|:|.::.:|:|
Mouse   559 KDLESMGYHFCDSLLDYCDPDRSKYYQCLKELEEMEKHLSSERV---SDNTDTSLVEISLDVES 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 49/256 (19%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 63/320 (20%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 55/276 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.