DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and AGBL3

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_848658.3 Gene:AGBL3 / 340351 HGNCID:27981 Length:920 Species:Homo sapiens


Alignment Length:248 Identity:52/248 - (20%)
Similarity:90/248 - (36%) Gaps:81/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ITKGGETINGKAKPGIFLEAGIHARE----WIAPAAATFIINQLLTSEVENIKELAENYTWYVLP 225
            ||...:..:.:.:..:.|.|.:|..|    ||......:|:.....:::     |.:.:.:.|:|
Human   342 ITTPLKNSDSRKRKAVILTARVHPGETNSSWIMKGFLDYILGNSSDAQL-----LRDTFVFKVVP 401

  Fly   226 HANPDGYVYTHTTNRLWRKTRTPYGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIET 290
            ..||||.:..:     :|      .|..|.|.|||:          :|...:::  ||.:  ...
Human   402 MLNPDGVIVGN-----YR------CSLAGRDLNRNY----------TSLLKESF--PSVW--YTR 441

  Fly   291 LSLSKFIEGLKGKVQLYLSLHAYSQ------------------YL---LYPYGHTSDLPDNVADF 334
            ..:.:.:|  |.:|.||..||.:|:                  ||   ::|...:.:.||..:  
Human   442 NMVHRLME--KREVILYCDLHGHSRKENIFMYGCDGSDRSKTLYLQQRIFPLMLSKNCPDKFS-- 502

  Fly   335 EKVFDASIAAVNK-RYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYE 386
               |.|....|.| :.||               |..|.|..|   :|.:|..|
Human   503 ---FSACKFNVQKSKEGT---------------GRVVMWKMG---IRNSFTME 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 48/234 (21%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 52/248 (21%)
AGBL3NP_848658.3 M14_AGBL2-3_like 310..570 CDD:133117 52/248 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.