DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and CG32379

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:302 Identity:110/302 - (36%)
Similarity:162/302 - (53%) Gaps:10/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAR 189
            :|...:...:|.||.:..|..|.:.:.|.:|:.|.:..:.||.|....|   ||.|.::..:|||
  Fly    44 FYTHSEINDYLDSLLERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRN---KPVILIDGTVHAR 105

  Fly   190 EWIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPYGS--C 252
            |||:|:.|.:||.|||.:..:| :||.::|.|.::|..|.|||.||||.:|.|||:|.|..:  |
  Fly   106 EWISPSMALYIIQQLLDNYGDN-QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPEC 169

  Fly   253 FGADPNRNWGFHW-NEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQY 316
            .|.|.|||:|:.| ::.|:||..|.:.|.|...|.:.|:..|...:...||::..|||||:|..|
  Fly   170 IGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNY 234

  Fly   317 LLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRM 381
            .|.|:|:|||.||...|...|.||...|:.......|:.|:.|..:||.:|.:.|:|:|..:..:
  Fly   235 FLLPWGYTSDFPDTYQDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATV 299

  Fly   382 AFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423
            |...||..:.   ..||.....||.....|....:.|||.||
  Fly   300 AMTMELPAAG---FQGFDPWISQIERLVTESWVGVRAMAAEV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 95/251 (38%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 108/300 (36%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 108/300 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467013
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.