DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and CG31019

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:314 Identity:68/314 - (21%)
Similarity:106/314 - (33%) Gaps:101/314 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HKVPDFLEILGKSEIKYEL-------QSRDVQKSLDEIDEKVAIKGRATTAYNWAQYYELDDTYA 133
            |.|..|..|..|.|..|:.       .|| :|..|:.||.:.....|.|..             .
  Fly   154 HYVLSFAFIFDKEEDVYQFALAWPYSYSR-LQSYLNVIDARQGSDKRFTRC-------------V 204

  Fly   134 WLQSLAQTNPGV-----VTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAREWIA 193
            .::||...|..:     ||..:.......||.:.|                |.:....|:.|   
  Fly   205 LVKSLQNRNVDLLTIDHVTAKQRSTNRLDRSFIRV----------------IVVLCRTHSSE--- 250

  Fly   194 PAAATFIINQLLTSEVEN---IKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPYGSCFGA 255
             |.|:.:...|:...|.|   ...|.:|:.:.::|..||||....:  ||.         :..|.
  Fly   251 -APASHVCQGLIEFLVGNHPIAAVLRDNFVFKIVPMVNPDGVFLGN--NRC---------NLMGQ 303

  Fly   256 DPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIE-GLKG--------------KVQ 305
            |.||||     .:| |.....:.:|......|::...:|:.|| .|.|              ::.
  Fly   304 DMNRNW-----HIG-SEFTQPELHAVKGMLKELDNSDVSRGIETDLIGIIFVCSYNISFQTYQID 362

  Fly   306 LYLSLHA-------------------YSQYLLYPYGHTSDLPDNVADFEKVFDA 340
            ..:.|||                   |.::|::|....|:..|.||| ..:|:|
  Fly   363 FVIDLHANSSMHGCFIYGNTYEDVYRYERHLVFPRLFASNAQDYVAD-HTMFNA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 68/314 (22%)
Propep_M14 34..105 CDD:280416 11/35 (31%)
M14_CP_A-B_like 125..423 CDD:199844 53/258 (21%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 57/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.