DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and CG43235

DIOPT Version :10

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster


Alignment Length:98 Identity:27/98 - (27%)
Similarity:51/98 - (52%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLAIVASASVSAERV---RYDNYRMYKVNSENAKQLEVLKDLEGSSDSI-MFLDGVHLVGADIQI 71
            ||.|.|..|..::.:   .|:||.:|||..:.....:|:..|...:|:. ::..|:::|    .|
  Fly     8 LLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVV----HI 68

  Fly    72 IVAPHKVPDFLEILGKSEIKYELQSRDVQKSLD 104
            :|:|.:...||.::.|..|..|:..::||..:|
  Fly    69 MVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 Propep_M14 33..105 CDD:460505 19/73 (26%)
Zn_pept 125..407 CDD:214748
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.