DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and AGBL1

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:291 Identity:58/291 - (19%)
Similarity:96/291 - (32%) Gaps:89/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 KPGIFLEAGIHARE----WIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHT 237
            :|...:.|.:|..|    |:......|:::   :..|..:  |.||:.:.::|..||||.:  :.
Human   794 RPYQVITARVHPGESNASWVMKGTLEFLVS---SDPVARL--LRENFIFKIIPMLNPDGVI--NG 851

  Fly   238 TNRLWRKTRTPYGSCFGADPNRNW---------------G--FHWNEVGASSSACSDTYAGPSAF 285
            .:|.         |..|.|.||.|               |  :|.:.:|.|          |..|
Human   852 NHRC---------SLSGEDLNRQWLSPSAHLQPTIYHAKGLLYHLSSIGRS----------PVVF 897

  Fly   286 SEIETLSLSK--FIEGLKGKVQLYLSLHAYSQYLLYPYGHTSDLP---DNVADFEKVFDASIAAV 345
            .:....|..|  |:.|...|..|:.:........:....:...||   |.:|....:...|....
Human   898 CDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILDKLAPAFTMSSCSFLVE 962

  Fly   346 NKRYGT-------------------TYTGGNIYDAIYPAAGASVDWAYGTQDVR---MAFC---- 384
            ..|..|                   :|.|.|        .|......:||:::.   ..||    
Human   963 KSRASTARVVVWREMGVSRSYTMESSYCGCN--------QGPYQGLQFGTRELEEMGAMFCLGLL 1019

  Fly   385 -YELRPSSTSYLTGFKLPAEQIVPASEELLD 414
             .||:.:|.|:  .....|..::.|.|:.||
Human  1020 ILELKSASCSH--QLLAQAATLLSAEEDALD 1048

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 45/241 (19%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 58/291 (20%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865
M14_Nna1 754..1019 CDD:349477 49/258 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.