DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17633 and cpo

DIOPT Version :9

Sequence 1:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:314 Identity:106/314 - (33%)
Similarity:173/314 - (55%) Gaps:19/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 AYNWAQYYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLE 183
            :|::.:|:.:|:..||:..:.:.||.||:.:..|:||:.|:|..:||.....|    .|..|:::
Zfish    29 SYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTT----PKKAIWMD 89

  Fly   184 AGIHAREWIAPAAATFIINQLLTS--EVENIKELAENYTWYVLPHANPDGYVYTHTTN--RLWRK 244
            .|||||||||||.....:.::|.|  ....:..|.:|..:|:.|..|.|||:|:...|  |||||
Zfish    90 CGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRK 154

  Fly   245 TRTP---YGSCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQL 306
            :|:|   ..:|.|.|.|||:..:|..||.|.:.||:.|.|.:|.||.|..:::.|:...:..:..
Zfish   155 SRSPCHENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLC 219

  Fly   307 YLSLHAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVD 371
            ||::|:|.|.:|.||||.:....|..:..:|..|:..|:...:|.:|..|:..|.:||.:|:|.|
Zfish   220 YLTIHSYGQLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRD 284

  Fly   372 WA--YGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423
            :|  .|   :..:|.:|||.....   ||.||.:||.|..:|..:..:::...|
Zfish   285 FARLIG---IPYSFTFELRDEGQH---GFILPEDQIQPTCQEAYEGAMSIINYV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 92/263 (35%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 104/306 (34%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 104/306 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.