DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AGBL4

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:320 Identity:66/320 - (20%)
Similarity:114/320 - (35%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NRRSDDYSWSEYHELNDT--HRWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRINHNDG---RAE 167
            :|..|.|.::..:....|  ..::.:|..:..|.......|||.:.|:|..|.|...|.   .||
Human   167 DREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAE 231

  Fly   168 KQSIFLEAGMHARE-----------------------------WIGPATATYFANELLSSQQQEI 203
            ::.:|:...:|..|                             |:.|....:..:      |..|
Human   232 QKVVFITGRVHPGETPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPGIIDFLVS------QHPI 290

  Fly   204 MNLARSY-VWYILPHANPDG-YVYTHKTNRMWRKTRSPQDKNCVGTDPNRNWDFHWREVGASSDP 266
            ..:.|.| |:.|.|..|||| |:..::.:.|             |.|.||:|             
Human   291 ACVLREYLVFKIAPMLNPDGVYLGNYRCSLM-------------GFDLNRHW------------- 329

  Fly   267 CSESYAGPKAFSEPEVQTLSQFLKSV---PEPMFMF-LSLHSFSQLLL-YPYGHTSALPENHRQL 326
                 ..|..:..|.:..:.|.:..:   |:....| :.:|:.|.::. :.||:... .|...|.
Human   330 -----LDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFE-DEERFQR 388

  Fly   327 EQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSF 386
            :.||...:......:....|..| .||:  .||:...:..|:|: ..|:.|.|..|.||:
Human   389 QAIFPKLLCQNAEDFSYSSTSFN-RDAV--KAGTGRRFLGGLLD-HTSYCYTLEVSFYSY 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 63/309 (20%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 62/297 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.